[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ribB
DDBJ      :ribB         riboflavin synthase  alpha-chain
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  782/915 : Eukaryota  114/199 : Viruses  0/175   --->[See Alignment]
b.43.4
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->183 1i8dA PDBj 6e-22 33.3 %
:RPS:PDB   1->182 3ddyA PDBj 1e-34 26.2 %
:RPS:SCOP  1->90 1i8dA1  b.43.4.3 * 9e-19 28.9 %
:RPS:SCOP  93->189 1i8dA2  b.43.4.3 * 6e-31 35.1 %
:HMM:SCOP  1->91 1kzlA1 b.43.4.3 * 4.6e-17 27.5 %
:HMM:SCOP  93->191 1i8dA2 b.43.4.3 * 6.9e-27 39.4 %
:RPS:PFM   10->84 PF00677 * Lum_binding 6e-07 32.0 %
:RPS:PFM   100->183 PF00677 * Lum_binding 2e-12 39.8 %
:HMM:PFM   4->85 PF00677 * Lum_binding 1.7e-16 29.3 82/85  
:HMM:PFM   99->183 PF00677 * Lum_binding 1.7e-25 38.8 85/85  
:BLT:SWISS 1->197 RISA_AQUAE 2e-38 39.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21851.1 GT:GENE ribB GT:PRODUCT riboflavin synthase alpha-chain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1016588..1017181) GB:FROM 1016588 GB:TO 1017181 GB:DIRECTION - GB:GENE ribB GB:PRODUCT riboflavin synthase alpha-chain GB:PROTEIN_ID AAZ21851.1 GB:DB_XREF GI:71062848 GB:GENE:GENE ribB LENGTH 197 SQ:AASEQ MFNGIIFNQGLITKFEKRSKGINIFVKANLKLTRKDLGVSVACDGVCLTLIDIKNLIMEFYLSDETIQRSKFKFLKINDKINLELPLKFGQKISGHICQGHIDAVGKIQSIKKIDKSYLFNFEIPKKERANLIDKASICINGISLTISKVTKKGFQVWVIPHTFKLTNLSSLKKGSLVNIEIDILSKYVRNYFNEKK GT:EXON 1|1-197:0| BL:SWS:NREP 1 BL:SWS:REP 1->197|RISA_AQUAE|2e-38|39.5|195/207| BL:PDB:NREP 1 BL:PDB:REP 1->183|1i8dA|6e-22|33.3|183/206| RP:PDB:NREP 1 RP:PDB:REP 1->182|3ddyA|1e-34|26.2|172/175| RP:PFM:NREP 2 RP:PFM:REP 10->84|PF00677|6e-07|32.0|75/84|Lum_binding| RP:PFM:REP 100->183|PF00677|2e-12|39.8|83/84|Lum_binding| HM:PFM:NREP 2 HM:PFM:REP 4->85|PF00677|1.7e-16|29.3|82/85|Lum_binding| HM:PFM:REP 99->183|PF00677|1.7e-25|38.8|85/85|Lum_binding| RP:SCP:NREP 2 RP:SCP:REP 1->90|1i8dA1|9e-19|28.9|90/93|b.43.4.3| RP:SCP:REP 93->189|1i8dA2|6e-31|35.1|97/113|b.43.4.3| HM:SCP:REP 1->91|1kzlA1|4.6e-17|27.5|91/92|b.43.4.3|1/2|Riboflavin synthase domain-like| HM:SCP:REP 93->191|1i8dA2|6.9e-27|39.4|99/113|b.43.4.3|2/2|Riboflavin synthase domain-like| OP:NHOMO 971 OP:NHOMOORG 911 OP:PATTERN ------------------------11111111-------------1---------1-111------11 1111111111111111111-11111111111111111111111111111111111-111111111111111----1-----11111111111-111---1111111111111111111111111111111111111111-111111112111111111111111111111111111111111111111---1111111111111111111111111111111111------1111111111111111111111--1----1---1-11----111-111111-------11111111111-----------------------11-11111111111111111111-111--1111111111211111-1-11111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---------------111111111111111222222111111111111111211111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111112221111112222222222222222222221-1111111-11111111111111111111-1111111111111111111111112211111111111111111111111111111111111111111111111111112121111111111111111111111111111111111111122221111111111111122221111122222111111111111111111111111------------------------------------11-111-111111 ------1-----111111111111111111111111-111-1111111111111-111-11111111111121111111111111111-1211111111111-111-11------------------------------------------------------------------111141111111-31111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 95.4 SQ:SECSTR cccccccEEEEEEEEEEccccEEEEEEccTTTGGGcTTcEEEETTEEEEEEEEETTEEEEEEcHTTTTTccGGGccTTcEEEEEccccTTcccccccccccccEEEEEEEEEccccEEEEEEEccTTTcccccTTcEEEETTEEEEccEEETTEEEEEEEGGGGGTccGGGccTTcEEEEEEcTHHHH######### DISOP:02AL 196-197| PSIPRED ccEEEEEEEEEEEEEEEcccEEEEEEcccccccccccccEEEEccEEEEEEEEcccEEEEEEEHHHHccccccccccccEEEEEcccccccccccEEEEEEEEEEEEEEEEEEcccEEEEEEEEcHHHHHHccccccEEEccEEEEEEEEcccEEEEEEcccHHHHcHHHHcccccEEEEEEEEHHHHHHHHHHccc //