[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ribF
DDBJ      :ribF         Riboflavin biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  853/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.43.5c.26.1
:305 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->303 1s4mA PDBj 2e-27 34.0 %
:RPS:PDB   12->175 2a86B PDBj 2e-12 16.2 %
:RPS:PDB   180->304 3bnwA PDBj 1e-32 20.8 %
:RPS:SCOP  17->185 1mrzA2  c.26.1.3 * 4e-13 21.0 %
:RPS:SCOP  198->304 1mrzA1  b.43.5.1 * 2e-27 39.2 %
:HMM:SCOP  13->181 1lw7A1 c.26.1.3 * 7.1e-33 34.6 %
:HMM:SCOP  172->307 1n08A_ b.43.5.1 * 2.5e-41 39.6 %
:RPS:PFM   14->165 PF06574 * FAD_syn 4e-21 33.6 %
:RPS:PFM   183->305 PF01687 * Flavokinase 6e-19 36.4 %
:HMM:PFM   182->304 PF01687 * Flavokinase 2e-43 46.3 121/125  
:HMM:PFM   11->165 PF06574 * FAD_syn 4.2e-43 38.1 155/158  
:BLT:SWISS 18->303 RIBF_HAEIN 4e-44 35.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20981.1 GT:GENE ribF GT:PRODUCT Riboflavin biosynthesis protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(162399..163316) GB:FROM 162399 GB:TO 163316 GB:DIRECTION - GB:GENE ribF GB:PRODUCT Riboflavin biosynthesis protein GB:PROTEIN_ID AAZ20981.1 GB:DB_XREF GI:71061978 GB:GENE:GENE ribF LENGTH 305 SQ:AASEQ MKLYKDFNISNNHKKSIILIGNFDGVHLGHQKLFKLANTYKKKFNLKIGVLTFEPMPKMFFNKNFKNFRISNINQKKIILDHLGVDFIITKKFDKKFSAIKSDFFIKEILSKKLEAQYIFVSNNFRFGNKREGDVRQLIKNEGRYHYKIVKPQPLILNKKVISSTYIRSLLEKGQLKKTNKLLSRNWSIEGIVQKGRQQGKKIGFPTCNIDIKDYVIAMPGVYAVKVKQKNSNKSLKAIANLGYRPTFNQKKILLEVHIFNFSGNLYNKYLSVEFTKFIRKEKKFKNVDQLKKQIQSDLKVAKKS GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 18->303|RIBF_HAEIN|4e-44|35.4|285/308| SEG 55->68|pmpkmffnknfknf| SEG 86->97|dfiitkkfdkkf| BL:PDB:NREP 1 BL:PDB:REP 17->303|1s4mA|2e-27|34.0|256/277| RP:PDB:NREP 2 RP:PDB:REP 12->175|2a86B|2e-12|16.2|148/277| RP:PDB:REP 180->304|3bnwA|1e-32|20.8|120/160| RP:PFM:NREP 2 RP:PFM:REP 14->165|PF06574|4e-21|33.6|152/157|FAD_syn| RP:PFM:REP 183->305|PF01687|6e-19|36.4|121/125|Flavokinase| HM:PFM:NREP 2 HM:PFM:REP 182->304|PF01687|2e-43|46.3|121/125|Flavokinase| HM:PFM:REP 11->165|PF06574|4.2e-43|38.1|155/158|FAD_syn| GO:PFM:NREP 4 GO:PFM GO:0003919|"GO:FMN adenylyltransferase activity"|PF06574|IPR015864| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF06574|IPR015864| GO:PFM GO:0008531|"GO:riboflavin kinase activity"|PF01687|IPR015865| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01687|IPR015865| RP:SCP:NREP 2 RP:SCP:REP 17->185|1mrzA2|4e-13|21.0|157/157|c.26.1.3| RP:SCP:REP 198->304|1mrzA1|2e-27|39.2|97/109|b.43.5.1| HM:SCP:REP 13->181|1lw7A1|7.1e-33|34.6|162/0|c.26.1.3|1/1|Nucleotidylyl transferase| HM:SCP:REP 172->307|1n08A_|2.5e-41|39.6|134/154|b.43.5.1|1/1|Riboflavin kinase-like| OP:NHOMO 877 OP:NHOMOORG 859 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-111111111111111111211111111111111111-11111112111111------1111111111111111111---1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111121221111111111212111212112222221111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111-1111111111111111111111111111111111111111111111---------------1111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111-11111111111111111111111111111111111-111111--11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111--------1-1-1--1---1--11----111--111111111-111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------1-11------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 96.7 SQ:SECSTR ##########HHTTccEEEEEEcccccHHHHHHHHHHHTcTTHHHccEEEEEEcccGGGccTTccGGGccccHHHHHHHHHTTTccEEEcccHHHHccTTcccccccccGGGTTTGGGHHcccEEEEEGGGHHHHHHHHHHTTcccEEEEEcccccTTcccccGGGGGGcccHHHHHHTccTTcccEEEEEEEEcccccHHcccccccEEcccHHHHHHHGGGTTEEEEEEEEETTEEEEEEEEEEEEEEcccEEEEEEcccccccTTcEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHH PSIPRED cEEEcccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHcccccccccccHHHHHHHHHHccccEEEEEcccHHHHcccHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHcccEEEEEccEEEccEEEcHHHHHHHHHcccHHHHHHHccccEEEEEEEEEcccccccccccEEEccccccccccccEEEEEEEEccccEEEEEEEEEccccEEcccEEEEEEEEEcccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHc //