[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : rpmJ
DDBJ      :rpmJ         ribosomal protein L36
Swiss-Prot:RL36_PELUB   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:41 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   20->40 3bbo6 PDBj 4e-04 66.7 %
:HMM:SCOP  1->41 2i2t41 g.42.1.1 * 4.2e-09 57.9 %
:HMM:PFM   1->41 PF00444 * Ribosomal_L36 2.7e-20 55.3 38/38  
:BLT:SWISS 20->41 RL36_PELUB 1e-08 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21394.1 GT:GENE rpmJ GT:PRODUCT ribosomal protein L36 GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 564660..564785 GB:FROM 564660 GB:TO 564785 GB:DIRECTION + GB:GENE rpmJ GB:PRODUCT ribosomal protein L36 GB:PROTEIN_ID AAZ21394.1 GB:DB_XREF GI:71062391 GB:GENE:GENE rpmJ LENGTH 41 SQ:AASEQ MKIKSSLKSLKKRDLNSKLVRRRGRVYIINKTNPKFKARQK GT:EXON 1|1-41:0| SW:ID RL36_PELUB SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=SAR11_0573; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 20->41|RL36_PELUB|1e-08|100.0|22/41| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| SEG 2->19|kiksslkslkkrdlnskl| BL:PDB:NREP 1 BL:PDB:REP 20->40|3bbo6|4e-04|66.7|21/38| HM:PFM:NREP 1 HM:PFM:REP 1->41|PF00444|2.7e-20|55.3|38/38|Ribosomal_L36| HM:SCP:REP 1->41|2i2t41|4.2e-09|57.9|38/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14, 35-41| PSIPRED cccHHHHHHHHHcccHHHHHHccccEEEEEccccccccccc //