[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : rsbU
DDBJ      :rsbU         Sigma factor sigB regulation protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  210/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.110.2
:448 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->205 1ykdB PDBj 4e-10 26.8 %
:RPS:PDB   43->209 3e0yA PDBj 1e-21 22.6 %
:RPS:SCOP  43->229 1mc0A1  d.110.2.1 * 3e-23 13.8 %
:HMM:SCOP  39->232 1mc0A1 d.110.2.1 * 1.7e-31 33.3 %
:RPS:PFM   58->200 PF01590 * GAF 6e-07 33.3 %
:RPS:PFM   269->446 PF07228 * SpoIIE 1e-11 24.2 %
:HMM:PFM   263->446 PF07228 * SpoIIE 3.7e-40 27.2 184/193  
:HMM:PFM   58->200 PF01590 * GAF 5.9e-11 27.1 140/154  
:HMM:PFM   23->82 PF05422 * SIN1 0.0004 23.7 59/523  
:BLT:SWISS 44->205 PDE11_TAKRU 4e-11 25.9 %
:BLT:SWISS 211->446 RSBU_BACSU 3e-27 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20889.1 GT:GENE rsbU GT:PRODUCT Sigma factor sigB regulation protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(77115..78461) GB:FROM 77115 GB:TO 78461 GB:DIRECTION - GB:GENE rsbU GB:PRODUCT Sigma factor sigB regulation protein GB:NOTE GAF photoreceptor fused to PP2C GB:PROTEIN_ID AAZ20889.1 GB:DB_XREF GI:71061886 GB:GENE:GENE rsbU LENGTH 448 SQ:AASEQ MNNEFHQSQNYQKFNEYQFINNMFFGAKKTETIKVDNTSVKDLELVTKMSQEFAKTLDLKETLQTSLELIIKRINAQAANIFLIDNDKQNFQCIASKHQAYLEDFEIPITQGVMGKAALMKQCIRVGDVRKDVREIAEFYFDLDNKTNFTTYSVLCSPLIVSDECIGVIHCLNKKTDNKLFEESDRKLLETLSGPAALAIRNAKMAKDLIVKNRIEKEIEIVGEIQKTLLSQNIKENFPIAGINIPAKVVSGDFYNFSELSNGVYGFGVADVSGKGIKSSLLMSKASSLYRCLSKTNFSAAGLLDILNTEICETTSRGMFVTMLVGIYDSNKKELTLSNAGHEPPLIYSKDGNFSNFEEAGPPLGIAPKFKFKETKINFSNSSMYIFTDGITEIRDAKGNMLEAEGFKDYIKKYQQIPNHERLNKIIEDIIKSGRIQKDDLTIVTVDG GT:EXON 1|1-448:0| BL:SWS:NREP 2 BL:SWS:REP 44->205|PDE11_TAKRU|4e-11|25.9|158/903| BL:SWS:REP 211->446|RSBU_BACSU|3e-27|31.2|234/335| SEG 278->289|kssllmskassl| BL:PDB:NREP 1 BL:PDB:REP 56->205|1ykdB|4e-10|26.8|149/380| RP:PDB:NREP 1 RP:PDB:REP 43->209|3e0yA|1e-21|22.6|146/153| RP:PFM:NREP 2 RP:PFM:REP 58->200|PF01590|6e-07|33.3|138/143|GAF| RP:PFM:REP 269->446|PF07228|1e-11|24.2|178/193|SpoIIE| HM:PFM:NREP 3 HM:PFM:REP 263->446|PF07228|3.7e-40|27.2|184/193|SpoIIE| HM:PFM:REP 58->200|PF01590|5.9e-11|27.1|140/154|GAF| HM:PFM:REP 23->82|PF05422|0.0004|23.7|59/523|SIN1| GO:PFM:NREP 1 GO:PFM GO:0004721|"GO:phosphoprotein phosphatase activity"|PF07228|IPR010822| RP:SCP:NREP 1 RP:SCP:REP 43->229|1mc0A1|3e-23|13.8|181/187|d.110.2.1| HM:SCP:REP 39->232|1mc0A1|1.7e-31|33.3|183/0|d.110.2.1|1/1|GAF domain-like| OP:NHOMO 467 OP:NHOMOORG 228 OP:PATTERN -------------------------------------------21112-------------------- 2B9-5--------------------------------------------11-1-----------1--222----------1-2--1--11---1------------2-1--111111-11--------11--2-2-78755---C-31144411111111111211145351111111111-1-----11--11------1-----11-111111----3311111111111-11111111111111111111-----------------------------------------------------------------------1--1-----------1--------11----1---1112---------1-11-------------11-------2------------------------1-----------12--------------------------3-------------------------------4--2---111-----------------------------------------1------------------------11C5-31-2-7511114724515-3-----514------------------------1-------1-------------1--------11---3-1--------1------------------------------------11--------------------------------------------------------1---------------------------------1----------------------------------------11111111-------3GH69A9---1--1-2---------------------------1--1211111131 ----------2-112-------------------------------------------------------------------------------------------------111--------------------------------------1---------11-1------22------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 38.4 SQ:SECSTR #####################################cccHHHHHHHHHcTTccccccHHHHHHHHHHHHHHHTTcccEEEEEEETTEEEEEEEEcccGGGTTTcEEETTTccHHHHHHHcccEEEEEEccccccccccccHHHHHHccccEEEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHT############################################################################################################################################################################################################################################### DISOP:02AL 1-10| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEcccccccccccccccccccHHHHcccEEEEccHHHcccccccccHHHHHHccccEEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccEEEEEEEEcccEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccEEEEEEccccccEEEccccEEEEEcccccEEEccccccccEEEEEEcccEEEEEccccEEccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccEEEEEEEc //