[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : rsbW
DDBJ      :rsbW         Anti-sigma regulatory factor (Ser/Thr protein kinase).
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   43->125 PF02518 * HATPase_c 5.9e-08 17.9 78/111  
:HMM:PFM   6->79 PF01326 * PPDK_N 0.00036 19.4 62/329  
:BLT:SWISS 11->143 RSBW_STAAU 2e-09 34.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20882.1 GT:GENE rsbW GT:PRODUCT Anti-sigma regulatory factor (Ser/Thr protein kinase). GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 67078..67512 GB:FROM 67078 GB:TO 67512 GB:DIRECTION + GB:GENE rsbW GB:PRODUCT Anti-sigma regulatory factor (Ser/Thr protein kinase). GB:PROTEIN_ID AAZ20882.1 GB:DB_XREF GI:71061879 GB:GENE:GENE rsbW LENGTH 144 SQ:AASEQ MSLENFSHSEKKDFLVSSASLKDVRAFSRDVFEKFKIDEDLREELVLAIAEAAQNIVKHAYKDMPDTQDKMVVRISCNDDVLEISFFDKGKPVEKSKVKHRAIDDIKPGGLGTFFIQQIMDSINFEPGKEPWINNLVLTKKLKN GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 11->143|RSBW_STAAU|2e-09|34.1|129/159| HM:PFM:NREP 2 HM:PFM:REP 43->125|PF02518|5.9e-08|17.9|78/111|HATPase_c| HM:PFM:REP 6->79|PF01326|0.00036|19.4|62/329|PPDK_N| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1-----------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------11-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 28.5 SQ:SECSTR ###################HHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHcccc#################################################################################### DISOP:02AL 1-8, 99-104| PSIPRED cccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHEEEEEEccccccEEEEEEEEEcc //