[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : scpA
DDBJ      :scpA         segregation and condensation protein a
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  235/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.1.15
:246 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  18->84 1bhwA  c.1.15.3 * 5e-08 16.4 %
:RPS:SCOP  174->243 1w1wE  a.4.5.57 * 4e-05 16.1 %
:RPS:PFM   26->243 PF02616 * ScpA_ScpB 3e-09 28.7 %
:HMM:PFM   26->101 PF02616 * ScpA_ScpB 1.8e-14 28.9 76/242  
:HMM:PFM   181->243 PF02616 * ScpA_ScpB 1.7e-05 26.8 56/242  
:BLT:SWISS 7->81 SCPA_EXIS2 1e-13 44.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21781.1 GT:GENE scpA GT:PRODUCT segregation and condensation protein a GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 955647..956387 GB:FROM 955647 GB:TO 956387 GB:DIRECTION + GB:GENE scpA GB:PRODUCT segregation and condensation protein a GB:PROTEIN_ID AAZ21781.1 GB:DB_XREF GI:71062778 GB:GENE:GENE scpA LENGTH 246 SQ:AASEQ MADSDSKNFNVDLDNYNGPLDVLLDLAKAQKVNLENISITLLADQFHNYITNEKNLNLESASEYLLMATWLTYLKSKLLLPGNPEEEFKVLEVAEKLKLQLKKLELIRLLSDQMLQRKRLGREIRTRGIKGNIRSIYSTEYKLNLYELLKSYSSIIMTKDFQRMNIPKLPVFTTEDGIKRIKEFFGKLIDWRNINELIPSSFKSGSKFKTTGKAGIFAGSLELVKEGNLTIKQENLFDDIYIKELK GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 7->81|SCPA_EXIS2|1e-13|44.0|75/251| SEG 85->110|eeefkvlevaeklklqlkklelirll| SEG 200->213|ssfksgskfkttgk| RP:PFM:NREP 1 RP:PFM:REP 26->243|PF02616|3e-09|28.7|209/220|ScpA_ScpB| HM:PFM:NREP 2 HM:PFM:REP 26->101|PF02616|1.8e-14|28.9|76/242|ScpA_ScpB| HM:PFM:REP 181->243|PF02616|1.7e-05|26.8|56/242|ScpA_ScpB| RP:SCP:NREP 2 RP:SCP:REP 18->84|1bhwA|5e-08|16.4|67/392|c.1.15.3| RP:SCP:REP 174->243|1w1wE|4e-05|16.1|62/70|a.4.5.57| OP:NHOMO 235 OP:NHOMOORG 235 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------11-----------------------1-------------------111-11-1--1------------------------------------------------------1-1111111111111111111--11111111--1--------11111111111111111111111-1--1-111------111--1-----------------------------------------------1-11-1111111-1-1-111---111-1-11-----1--11--1111----1-1111-----111111111111111111111111---1-11--111-1111111111111111-111111111111111111111-1111-----------------------------11-11-------------------1---------1----1-----------------1--------------------1-------------111-111-1----11---------------------------11---------1-1---------------------11-1--------------------------------------------------------------------------------------------1----------1-----------------------------1----1-11-11111111----------------------------------1111---1---------------------1----1---111---------11-111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 86-88, 162-165| PSIPRED ccccccccEEEEcccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccEEEEEEcccccccEEEEcc //