[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : sdhB
DDBJ      :sdhB         Succinate dehydrogenase iron-sulfur protein
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  633/915 : Eukaryota  187/199 : Viruses  0/175   --->[See Alignment]
a.1.2d.15.4
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->256 1yq3B PDBj 3e-89 63.5 %
:RPS:PDB   29->255 2bs2B PDBj 4e-28 25.8 %
:RPS:SCOP  28->126 1kf6B2  d.15.4.2 * 7e-17 31.6 %
:RPS:SCOP  133->255 1e7pB1  a.1.2.1 * 1e-35 23.0 %
:HMM:SCOP  26->128 1nekB2 d.15.4.2 * 7.9e-27 34.3 %
:HMM:SCOP  129->259 1nekB1 a.1.2.1 * 1.3e-37 37.4 %
:HMM:PFM   71->96 PF00111 * Fer2 0.0001 26.9 26/77  
:BLT:SWISS 1->254 DHSB_PARDE e-100 63.0 %
:PROS 80->88|PS00197|2FE2S_FER_1
:PROS 170->181|PS00198|4FE4S_FER_1
:PROS 80->89|PS00518|ZF_RING_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21063.1 GT:GENE sdhB GT:PRODUCT Succinate dehydrogenase iron-sulfur protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(244386..245159) GB:FROM 244386 GB:TO 245159 GB:DIRECTION - GB:GENE sdhB GB:PRODUCT Succinate dehydrogenase iron-sulfur protein GB:PROTEIN_ID AAZ21063.1 GB:DB_XREF GI:71062060 GB:GENE:GENE sdhB LENGTH 257 SQ:AASEQ MVQINLPKNSEVQKGNYYQDKTGSKNIRKVNVYRWDPSNGENPRVDTYEVDMDNCPSKVLDILNKIKNEIDPSLAYRRSCAHGVCGSCAMNMDGKNGLACTKPHSEIEGDINIYPLPHLKVKKDLIGDLSGLYKQYESIEPWLKTNTKVETTEILQTKEDRVKLDGAYECIMCACCSTSCPSYWWNGDKYLGPAVLLQAYRWIVDSRDDEKKERLKKVADELKLYRCHTIMNCTNACPKGLNPAKAIAELKKMLATS GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 1->254|DHSB_PARDE|e-100|63.0|254/259| PROS 80->88|PS00197|2FE2S_FER_1|PDOC00175| PROS 170->181|PS00198|4FE4S_FER_1|PDOC00176| PROS 80->89|PS00518|ZF_RING_1|PDOC00449| BL:PDB:NREP 1 BL:PDB:REP 24->256|1yq3B|3e-89|63.5|233/242| RP:PDB:NREP 1 RP:PDB:REP 29->255|2bs2B|4e-28|25.8|225/239| HM:PFM:NREP 1 HM:PFM:REP 71->96|PF00111|0.0001|26.9|26/77|Fer2| RP:SCP:NREP 2 RP:SCP:REP 28->126|1kf6B2|7e-17|31.6|98/105|d.15.4.2| RP:SCP:REP 133->255|1e7pB1|1e-35|23.0|122/133|a.1.2.1| HM:SCP:REP 26->128|1nekB2|7.9e-27|34.3|102/106|d.15.4.2|1/1|2Fe-2S ferredoxin-like| HM:SCP:REP 129->259|1nekB1|1.3e-37|37.4|131/0|a.1.2.1|1/1|alpha-helical ferredoxin| OP:NHOMO 1185 OP:NHOMOORG 873 OP:PATTERN 11-1-11111111111112121-1111111111111111111111111-1---1-------1111-11 -1-12---------22233-32112233333222222143111-121-1111111111--11--222221-1111111-112122222-----------1--------1-11111111111111111111211132--------111111111-1--------12111111------------11111---1111111111111111111111111111111111------1111111111111111111111---------------------------------------------------------------------------------------11---------2--1111-12---2---------1-111111111121111111111111111111111-11111212111111111111111111111122212211111111111111-11111121111111111111111111111111111111-111121221212222244122222-2121111111231111111111222121-1-221111111111212-11--111121222-----1--------11-31221122221111111111122323--221111111122333313222232222322--11121------22222212222222222-221222222222222222222222222222222222222222222222222112222222222221111111111111111111111111111111111111111111111111111111111111111111111112222222222222211111111111111--1-------------------------------------------------------- 11--111-522-11111111111111111111111111111111111111111111111111111111112111111-1111111111-111111121111-1212-11-1242211111112111131161-11211111111-11111111111211-2311112211211211111K1111112831361122221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 233 STR:RPRED 90.7 SQ:SECSTR #######################cccEEEEEEEEccTTcTTccEEEEEEEEccTTcccHHHHHHHHHHHTcTTcccccccccccccTTEEEETTEEEEGGGccGGGcTTcEEEEccTTcEEEETTEEEcHHHHHHHHHHTTcccccccTTcccccccHHHHHHHHHHHTcccccHHHHTcHHHHHcTTTccHHHHHHHHHHHHTcTTccccHHHHHHHHccTTGGGcccccHHHHHcTTcccHHHHHHHHHHHHTH# DISOP:02AL 3-26, 152-153| PSIPRED cEEEEcccccccccccccccccccccEEEEEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccccccccEEEEcccccHHHcccHHHccccEEEEEcccccHHHHHHccccHHHHHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHcc //