[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : serS
DDBJ      :serS         serine-tRNA ligase
Swiss-Prot:SYS_PELUB    RecName: Full=Seryl-tRNA synthetase;         EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase;         Short=SerRS;

Homologs  Archaea  55/68 : Bacteria  911/915 : Eukaryota  194/199 : Viruses  0/175   --->[See Alignment]
a.2.7d.104.1
:419 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->410 2dq3A PDBj 3e-97 49.1 %
:RPS:PDB   1->416 2dq0A PDBj 4e-86 36.0 %
:RPS:SCOP  107->416 1serA2  d.104.1.1 * 5e-50 37.2 %
:HMM:SCOP  1->103 1setA1 a.2.7.1 * 2.7e-24 32.0 %
:HMM:SCOP  104->417 1setA2 d.104.1.1 * 7.6e-90 40.1 %
:RPS:PFM   163->332 PF00587 * tRNA-synt_2b 6e-13 29.3 %
:HMM:PFM   163->337 PF00587 * tRNA-synt_2b 2.9e-35 21.8 170/173  
:HMM:PFM   1->98 PF02403 * Seryl_tRNA_N 7.3e-16 38.8 98/108  
:BLT:SWISS 1->419 SYS_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21786.1 GT:GENE serS GT:PRODUCT serine-tRNA ligase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 958299..959558 GB:FROM 958299 GB:TO 959558 GB:DIRECTION + GB:GENE serS GB:PRODUCT serine-tRNA ligase GB:PROTEIN_ID AAZ21786.1 GB:DB_XREF GI:71062783 GB:GENE:GENE serS LENGTH 419 SQ:AASEQ MHNIKKIRNDVEAFKKALNKRFIEIDVDKILSLDENNRDYIQQRELLEKEKKDISKSKDQSLFEKSKKITVEIDNISKLQAGVKNELETILSSIPNIPHPDVPTGKDENSNVEISKSGTIPNFKFKPKSHYELGENLNMLDFDLATKTTGSRFVFVKDKLAMLERALSNFMLDTHVNTNGYEEISPPLIATDATMYGTGQLPKFDNDQFELKLDDSSDRKFLIPTAEVILTNIVKDQIIDKKKLPMRMVASTPCFRKEAGSYGKDTKGMIRQHQFYKVEMVSIVEIDKCLPELDRMTDCATKILDLLKLPYRKIVLCTGDMGFSAEKTFDIEVWLPSEDKYREISSCSSCGSFQARRMKARYKNEKKETVLVGTLNGSGLAVGRTLVAILENYQQEDGSILVPEALKPYMNNIEKIVKI GT:EXON 1|1-419:0| SW:ID SYS_PELUB SW:DE RecName: Full=Seryl-tRNA synthetase; EC=6.1.1.11;AltName: Full=Seryl-tRNA(Ser/Sec) synthetase;AltName: Full=Serine--tRNA ligase; Short=SerRS; SW:GN Name=serS; OrderedLocusNames=SAR11_0978; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->419|SYS_PELUB|0.0|100.0|419/419| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 45->62|ellekekkdiskskdqsl| BL:PDB:NREP 1 BL:PDB:REP 3->410|2dq3A|3e-97|49.1|399/422| RP:PDB:NREP 1 RP:PDB:REP 1->416|2dq0A|4e-86|36.0|411/447| RP:PFM:NREP 1 RP:PFM:REP 163->332|PF00587|6e-13|29.3|164/170|tRNA-synt_2b| HM:PFM:NREP 2 HM:PFM:REP 163->337|PF00587|2.9e-35|21.8|170/173|tRNA-synt_2b| HM:PFM:REP 1->98|PF02403|7.3e-16|38.8|98/108|Seryl_tRNA_N| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF00587|IPR002314| GO:PFM GO:0004812|"GO:aminoacyl-tRNA ligase activity"|PF00587|IPR002314| GO:PFM GO:0005524|"GO:ATP binding"|PF00587|IPR002314| GO:PFM GO:0005737|"GO:cytoplasm"|PF00587|IPR002314| GO:PFM GO:0006412|"GO:translation"|PF00587|IPR002314| GO:PFM GO:0006418|"GO:tRNA aminoacylation for protein translation"|PF00587|IPR002314| RP:SCP:NREP 1 RP:SCP:REP 107->416|1serA2|5e-50|37.2|304/311|d.104.1.1| HM:SCP:REP 1->103|1setA1|2.7e-24|32.0|103/110|a.2.7.1|1/1|tRNA-binding arm| HM:SCP:REP 104->417|1setA2|7.6e-90|40.1|307/0|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 1446 OP:NHOMOORG 1160 OP:PATTERN 1111111111111111111111111111111111---------1-111--111-11111111111111 1111111111111111111-11111111111111111111111211111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111221111111211111111111111211111111111111111111211111111112211111111111111111111111111111111111111111111111111111111111121222222212112111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111-11111111111111111111111111111111 2111222141112222222222222222221222222222222222322223232222222222222212222222222122222222-24222222222222334122263224312122-2244-225M2-3351121322211221122132111322423321221-22122222N2222243742422242222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 419 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHcHHHHHHHHHHHTcGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHTccccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccTTccccccGGGcEEEEEEccEEEEGcccccHHHHHHHTTcEEcHHHHHHTcTTccEEcHHHHHHHHHHHHHHHHHHHHHTTcEEEccccEEcHHHHHTTccTTHHHHTccccTTccTTcccEEcccTHHHHHHTTTTEEEETTTccEEEEEEEEEEcccTTcccccccccccccEEEEEEEEEEEcTTTHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccccccEEEEEEEEETTTTEEEEEEEEEEcTTTTHHHHTEEEEcTTcccEEcEEEEEEEEEHHHHHHHHHHHcccTTccEEccGGGHHHHcccEEcccc DISOP:02AL 49-74| PSIPRED cccHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEccccccccccccHHHHHHHccccccccccHHccccccEEcccHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHcccccccccccEEEEccccccccEEEcccHHHHHHHHHcccccHHHcccHHHHHccHHHccccccccccccEEcHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEEcccccccEEEEEEccHHHHHHHHcccEEEcccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEccHHHHHHcccEEEEccc //