[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : set1
DDBJ      :set1         Nuclear protein SET
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  84/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
b.85.7
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->133 2w5zA PDBj 6e-20 38.7 %
:RPS:PDB   8->136 3dalB PDBj 1e-17 19.0 %
:RPS:SCOP  1->122 1h3iA2  b.85.7.1 * 8e-21 19.7 %
:HMM:SCOP  2->135 1ml9A_ b.85.7.1 * 2.9e-43 37.3 %
:RPS:PFM   17->113 PF00856 * SET 2e-08 39.2 %
:HMM:PFM   15->114 PF00856 * SET 3.8e-26 36.7 98/158  
:BLT:SWISS 14->133 MLL3_MOUSE 1e-20 36.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21281.1 GT:GENE set1 GT:PRODUCT Nuclear protein SET GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(453922..454401) GB:FROM 453922 GB:TO 454401 GB:DIRECTION - GB:GENE set1 GB:PRODUCT Nuclear protein SET GB:PROTEIN_ID AAZ21281.1 GB:DB_XREF GI:71062278 GB:GENE:GENE set1 LENGTH 159 SQ:AASEQ MKLYKIKKSDIDKKGRGLYAAKDIKKGTRIIDYVGKIITKKQTEESQKFDNAKPIYLFNLNKKYDLDGDVSWNTARLINHSCSNNCDYNGTGLKLWVVAIKDIKKGEEITADYGFGYDEDYKQFPCKCKSKNCCGYIVRAESRWRINKKFSIGRQKTSK GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 14->133|MLL3_MOUSE|1e-20|36.7|120/4903| BL:PDB:NREP 1 BL:PDB:REP 15->133|2w5zA|6e-20|38.7|119/180| RP:PDB:NREP 1 RP:PDB:REP 8->136|3dalB|1e-17|19.0|126/166| RP:PFM:NREP 1 RP:PFM:REP 17->113|PF00856|2e-08|39.2|97/146|SET| HM:PFM:NREP 1 HM:PFM:REP 15->114|PF00856|3.8e-26|36.7|98/158|SET| RP:SCP:NREP 1 RP:SCP:REP 1->122|1h3iA2|8e-21|19.7|122/151|b.85.7.1| HM:SCP:REP 2->135|1ml9A_|2.9e-43|37.3|134/0|b.85.7.1|1/1|SET domain| OP:NHOMO 1164 OP:NHOMOORG 278 OP:PATTERN -------------------------------------------1------------------------ 111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-1-----------11111111111-----------------------------------------------------------------1------------------------------1-----1111111111111111112311111112311111111-1111111111121------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111---------------------------------------------------------1- 2112234-2-1233343323333252322231322213332332214432333222242222322222-211232-211212222222-23232222212222546-3449FGEIBA86445B6HI3C5V*E4GDQ6455A66B72A546B62C4CECB689C7985D69E5B872253Q52233677D3954454443 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 86.2 SQ:SECSTR EHTcEEEEEcccccEEEEEEcccccTTEEEcccccEEEcGGGccccTTEEEEETcETTEEEEEEEcccTTcccGGGGcEEcccTTTEEEEETTEEEEEEcccccTTcccEEEEcHHHHHHHTTcccTTcccHHHHTE###################### DISOP:02AL 3-4, 136-159| PSIPRED ccEEEEEEEEEccccEEEEEccccccccEEEEEEcccccHHHHHHHHHHHccccEEEEcccccEEEccccccccHHEEccccccccEEEEccEEEEEEEccccccccEEEEEcccccccccccccccccccccccEEcccccHHHHHHHHHHHcccccc //