[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : sfsA
DDBJ      :sfsA         sugar fermentation stimulation protein
Swiss-Prot:SFSA_PELUB   RecName: Full=Sugar fermentation stimulation protein homolog;

Homologs  Archaea  30/68 : Bacteria  341/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->142 2chuB PDBj 8e-04 25.6 %
:RPS:SCOP  43->183 1t62A  b.122.1.4 * 3e-16 7.5 %
:RPS:PFM   13->214 PF03749 * SfsA 5e-47 49.0 %
:HMM:PFM   13->227 PF03749 * SfsA 5.1e-72 44.6 213/216  
:BLT:SWISS 1->214 SFSA_PELUB e-121 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21938.1 GT:GENE sfsA GT:PRODUCT sugar fermentation stimulation protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1090073..1090771 GB:FROM 1090073 GB:TO 1090771 GB:DIRECTION + GB:GENE sfsA GB:PRODUCT sugar fermentation stimulation protein GB:PROTEIN_ID AAZ21938.1 GB:DB_XREF GI:71062935 GB:GENE:GENE sfsA LENGTH 232 SQ:AASEQ MEFTKALIKGKLIKRYKRFFADVKIGKEIVTAHCPNTGSMKGLLDEGNMVYVSKNDDPKRKLKYTLEIIKVKKNLVGVNTHFANKIAFHGLVNNLVKEVANNDSIKAEVFFDKETRFDFLVEKNKQKIFVEVKNVTLFREEKTAEFPDAVTTRGSKHLKTLIEAVKKGYKSYLLFLVQIEGVDNFKIAKDIDKEYYENYLLAKKAGVNFLAYQCKINSKEIKIDKKIKIINA GT:EXON 1|1-232:0| SW:ID SFSA_PELUB SW:DE RecName: Full=Sugar fermentation stimulation protein homolog; SW:GN Name=sfsA; OrderedLocusNames=SAR11_1135; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->214|SFSA_PELUB|e-121|100.0|214/232| SEG 215->230|kinskeikidkkikii| BL:PDB:NREP 1 BL:PDB:REP 52->142|2chuB|8e-04|25.6|90/283| RP:PFM:NREP 1 RP:PFM:REP 13->214|PF03749|5e-47|49.0|200/216|SfsA| HM:PFM:NREP 1 HM:PFM:REP 13->227|PF03749|5.1e-72|44.6|213/216|SfsA| RP:SCP:NREP 1 RP:SCP:REP 43->183|1t62A|3e-16|7.5|134/153|b.122.1.4| OP:NHOMO 381 OP:NHOMOORG 377 OP:PATTERN ----11-1111122111111-11-----1---111--------------1-----1-1111111---- -----------------------------------------------------------------------------------11111------------------------------------------------111----1--1111111111111111111111111111111111111-----11-------------------11----------------------------------------------11---------11------------------------------------------------------111111111111111-111111-11--1-11-11-1--1111111-1-1---1111-1111-------------11111111111-111111111---1111--1---1111--111-----111-------------111-----------------------------1----------------------------------------------------------------------------111111111111111111111111------11-----------------------1-1111-111111111111111111111111111---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1----------1111111111-11111111----------1111111111111111111----------11111111111111----------------1--------------------------------------------1--11-111--- ------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------1---------1211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 38.8 SQ:SECSTR ###################################################HHHHHHHHHHHHHHHHTccTTcEEEEEEEE#TTEEEEEcTTcTHHHHTTccEEccccccccEEEcHHHHHHHcccEEEEEEHHHHHTcccc########################################################################################## DISOP:02AL 232-233| PSIPRED cccccccEEEEEEEEcccEEEEEEEccEEEEEEEcccccccHHHccccEEEEEEcccccccccEEEEEEEEccEEEEEcccccHHHHHHHHHcccccccccccEEEEEEEcccccEEEEEEcccccEEEEEEEEEEEEEcccEEEccccccHHHHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEcHHHcHHHHHHHHHHHHcccEEEEEEEEEcccEEEEcccEEEEcc //