[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : soxG
DDBJ      :soxG         sarcosine oxidase gamma subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.250.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->160 1vrqC PDBj 5e-05 25.9 %
:HMM:SCOP  37->157 1wosA2 d.250.1.1 * 0.00084 24.5 %
:RPS:PFM   6->160 PF04268 * SoxG 6e-17 31.5 %
:HMM:PFM   10->160 PF04268 * SoxG 2.7e-24 26.4 140/147  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21872.1 GT:GENE soxG GT:PRODUCT sarcosine oxidase gamma subunit GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1036522..1037010 GB:FROM 1036522 GB:TO 1037010 GB:DIRECTION + GB:GENE soxG GB:PRODUCT sarcosine oxidase gamma subunit GB:PROTEIN_ID AAZ21872.1 GB:DB_XREF GI:71062869 GB:GENE:GENE soxG LENGTH 162 SQ:AASEQ MKLIIRGKTKDFITAVGKNLNMVLPTEANTSTSAEKLTAFWLSPDEWMLISNETVSEESNTYQVEDELIKNISKVKLGAVTDVSDQFVMLNIKGGKVFDLFATGSPFNFNDFKTKKGPVVQTILSHIDVIIHHKEINEVNLFVRRSFSEHLHSWLSDSASRL GT:EXON 1|1-162:0| BL:PDB:NREP 1 BL:PDB:REP 41->160|1vrqC|5e-05|25.9|112/195| RP:PFM:NREP 1 RP:PFM:REP 6->160|PF04268|6e-17|31.5|146/147|SoxG| HM:PFM:NREP 1 HM:PFM:REP 10->160|PF04268|2.7e-24|26.4|140/147|SoxG| HM:SCP:REP 37->157|1wosA2|0.00084|24.5|110/278|d.250.1.1|1/1|Folate-binding domain| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------1-------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------11---------1------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------1---------------------------1111----1------11------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 74.7 SQ:SECSTR #################################TTccEEEEEETTEEEEEEcccTH######THHHHHHHHHTTccccEEEEcTTTcccEEEEcTTHHHHHTTTccccccTTTccccEEEEEEETTEEEEEEEEETTEEEEEccGGGHHHHHHHHHHHHH## DISOP:02AL 162-163| PSIPRED cEEEEEccHHHHHHHHHHHcccccccccccEEEcccEEEEEEcccEEEEEEcccccccHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEccHHHHHHHHHHccccccccccccccEEEEEEccEEEEEEEccccEEEEEEEccHHHHHHHHHHHHcccc //