[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : speB1
DDBJ      :speB1        arginase
Swiss-Prot:             

Homologs  Archaea  51/68 : Bacteria  319/915 : Eukaryota  109/199 : Viruses  0/175   --->[See Alignment]
c.42.1
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   104->289 1wogA PDBj 2e-17 28.6 %
:RPS:PDB   21->290 2ef5A PDBj 6e-43 22.3 %
:RPS:SCOP  13->289 1wogA  c.42.1.1 * 9e-51 21.5 %
:HMM:SCOP  20->292 2aebA1 c.42.1.1 * 1.6e-64 31.5 %
:RPS:PFM   23->285 PF00491 * Arginase 9e-28 35.8 %
:HMM:PFM   22->285 PF00491 * Arginase 9.7e-65 32.4 256/274  
:BLT:SWISS 2->287 SPEB1_SYNY3 4e-39 33.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21028.1 GT:GENE speB1 GT:PRODUCT arginase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 208096..208971 GB:FROM 208096 GB:TO 208971 GB:DIRECTION + GB:GENE speB1 GB:PRODUCT arginase GB:PROTEIN_ID AAZ21028.1 GB:DB_XREF GI:71062025 GB:GENE:GENE speB1 LENGTH 291 SQ:AASEQ MKYLSNKNGFLGIDNDVNFKEKVVVVPFGLEKTVSYGGGTRNGPKEIIKASHQVELYDEELHCEPYKKIGIKTLKPFKIDKDIKKALKKMSDINQEILDKKLFPITFGGEHSITPGCIAPFVKKYKDICLLHFDAHADLRESYNGEKFSHASAIKRCLDHKNVSIISFGIRNISQSEIPFLKKNSSRINIFWAKDKNKWDLKKFKKMIKNKTVYLTFDVDGLDSSIMPATGTPEPGGLLWDETLDIIRIAAKNSNIVGADINELSPIKGFNSYNFLVAKLAYKILSYKFLY GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 2->287|SPEB1_SYNY3|4e-39|33.2|283/306| SEG 78->89|kidkdikkalkk| SEG 194->206|kdknkwdlkkfkk| BL:PDB:NREP 1 BL:PDB:REP 104->289|1wogA|2e-17|28.6|182/303| RP:PDB:NREP 1 RP:PDB:REP 21->290|2ef5A|6e-43|22.3|256/273| RP:PFM:NREP 1 RP:PFM:REP 23->285|PF00491|9e-28|35.8|246/266|Arginase| HM:PFM:NREP 1 HM:PFM:REP 22->285|PF00491|9.7e-65|32.4|256/274|Arginase| GO:PFM:NREP 2 GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF00491|IPR006035| GO:PFM GO:0046872|"GO:metal ion binding"|PF00491|IPR006035| RP:SCP:NREP 1 RP:SCP:REP 13->289|1wogA|9e-51|21.5|274/303|c.42.1.1| HM:SCP:REP 20->292|2aebA1|1.6e-64|31.5|270/0|c.42.1.1|1/1|Arginase/deacetylase| OP:NHOMO 651 OP:NHOMOORG 479 OP:PATTERN 221-1122222222211------11--1--1-111111111111111--1111-11112122112--1 -1-1---------------------3-------222-------1--------1---------1---1---1-------------------------1--11-1221--------------------------------------132-2---211--11111122-11111111111111111111111111312222222222222221211232222122-21------2-111111111111111----1----------------------------------------------------------------------1211--------1-11111-111111--1---1111111-1111111--1----------------------------------------------1--3--2--222211-------1----224---------------------------------------------2---1-1----2225221111-22312222-2422------1--------1-21----------111111112----111-11-11--11------------11112-11--------------------------------21-11------------1-1--11-------------11--1111111111111-1111111111111111111222--1111111111111111111211111111-------------11--11111-------1---------------1------1-1---1111222122321---------------11-1111111111----------------1-----------------1-------------------------------1------ 12------1---1111---11121112----------------1-1-----1-1--1--1111-3-1-----111------22211-1-111-12211-1-11211-1-121211211-1-11112111171-112111131211121221123322-4243-42--------2-----7-----1112-2-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 286 STR:RPRED 98.3 SQ:SECSTR ####cccccGGGGcccccGGcEEEEEEEcccccEcccccGGGHHHHHHHTTHHHHHHHTTcEEEEEEEcEEcccccTTHHHHHHHHHHHHHHHHHHTccTTEEEEEEEccGGGHHHHHHHHHTTccccEEEEEccccccccTTTccccGGGcHHHHHTTccGGGEEEEEEccccHHHHHHHHHHTTTcEEEEHHHHHHHcHHHHHHHHHTccEEEEEEGGGccTTTcccccccccccccHHHHHHHHHHHHHHTcEEEEEEEcccTTTccTHHHHHHHHHHHHHTTcccc# DISOP:02AL 1-6| PSIPRED cccccccccEEcccccccccccEEEEEccccccccccccHHHHHHHHHHHHHHccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHccEEEEEHHHHHcccHHHHHHHHccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHcc //