[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ssb
DDBJ      :ssb          single-strand binding protein (ssb)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  502/915 : Eukaryota  44/199 : Viruses  4/175   --->[See Alignment]
b.40.4
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->105 1qvcD PDBj 1e-27 51.5 %
:RPS:PDB   4->106 2dudA PDBj 5e-23 42.2 %
:RPS:SCOP  6->111 1se8A  b.40.4.3 * 6e-25 25.8 %
:HMM:SCOP  4->152 1se8A_ b.40.4.3 * 6e-44 40.6 %
:RPS:PFM   5->104 PF00436 * SSB 8e-17 40.2 %
:HMM:PFM   5->106 PF00436 * SSB 1.2e-39 52.5 99/104  
:BLT:SWISS 1->115 SSB_AGRT5 2e-36 57.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21792.1 GT:GENE ssb GT:PRODUCT single-strand binding protein (ssb) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 965942..966400 GB:FROM 965942 GB:TO 966400 GB:DIRECTION + GB:GENE ssb GB:PRODUCT single-strand binding protein (ssb) GB:NOTE helix-destabilizing protein GB:PROTEIN_ID AAZ21792.1 GB:DB_XREF GI:71062789 GB:GENE:GENE ssb LENGTH 152 SQ:AASEQ MAGSLNKVLLIGRLGADPEIKQMVNGKSVARLSLATSQSWKDKTTGEKKEKTEWHRIVVFNDGLVNVVQQYLKKGAQIYVEGQIATRKWKDEQSGQDKYSTEIVIQGYNSSLTMLGGGNTGGGIQNDNTQGPANNFEDSPQTSNDMDDEIPF GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->115|SSB_AGRT5|2e-36|57.0|114/173| SEG 41->53|kdkttgekkekte| SEG 116->131|gggntgggiqndntqg| BL:PDB:NREP 1 BL:PDB:REP 5->105|1qvcD|1e-27|51.5|99/140| RP:PDB:NREP 1 RP:PDB:REP 4->106|2dudA|5e-23|42.2|90/95| RP:PFM:NREP 1 RP:PFM:REP 5->104|PF00436|8e-17|40.2|97/104|SSB| HM:PFM:NREP 1 HM:PFM:REP 5->106|PF00436|1.2e-39|52.5|99/104|SSB| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF00436|IPR000424| RP:SCP:NREP 1 RP:SCP:REP 6->111|1se8A|6e-25|25.8|97/213|b.40.4.3| HM:SCP:REP 4->152|1se8A_|6e-44|40.6|143/0|b.40.4.3|1/1|Nucleic acid-binding proteins| OP:NHOMO 711 OP:NHOMOORG 550 OP:PATTERN -------------------------------------------------------------------- 111-------------------------------------------------------------------------------------121212111--11224211121---------------11111111111333221113----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------1---------------1--2--211215417111122121111111111111112-11111111311111111111111112111112121113111111111111112111111111111111111111111111111111131111112211111111112211111111131112211331121111211121111111-2111111111111112111111111111111121211311111211-------------------------331111211111111111111211211111111-2111111111111112111221121221-2112242111221221221311111232111211121222213311111111111111111111111111111122221111111112123112222111112211111111111112111211121111111111112111112111111111111111-4323111--------------------------------------------1--1-------- 11------1------------------------------------------------------------------------------------------------------111-111----1142-11741-111--1-2-11111-1-11-2-1112----3---2--1--111------------1-----1---- -----------------------------1-----------1---1--------------1------------------------------------------------------------------------------------------------------------------ STR:NPRED 114 STR:RPRED 75.0 SQ:SECSTR TTcccccEEEEEEEccccEEccETTTEccEEEEEEEEEEcccEEEEEEccEEEEEEEEEccHHHHHHHHHHccTTcEEEEEEEEEEEEEEcEcccEEEEEEEEEEEEEEEcccc###################################### DISOP:02AL 43-45, 110-147| PSIPRED ccccEEEEEEEEEEccccEEEEcccccEEEEEEEEEcccccccccccccccccEEEEEEEccHHHHHHHHHcccccEEEEEEEEEEcEEEccccccEEEEEEEEEEEEccEEEEcccccccccccccccccccccccccccccccccccccc //