[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : sucD
DDBJ      :sucD         Succinyl-CoA synthetase alpha chain (SCS-alpha)
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  672/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.23.4
:291 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->288 2fpgA PDBj 9e-77 63.0 %
:RPS:PDB   2->285 1cqjA PDBj 4e-43 52.3 %
:RPS:SCOP  2->122 1cqiA1  c.2.1.8 * 2e-20 55.4 %
:RPS:SCOP  123->285 1cqiA2  c.23.4.1 * 8e-40 50.0 %
:HMM:SCOP  1->122 1eucA1 c.2.1.8 * 1.5e-49 50.0 %
:HMM:SCOP  123->290 1oi7A2 c.23.4.1 * 3.5e-59 41.9 %
:RPS:PFM   9->99 PF02629 * CoA_binding 7e-09 38.5 %
:RPS:PFM   151->272 PF00549 * Ligase_CoA 1e-09 32.0 %
:HMM:PFM   6->99 PF02629 * CoA_binding 7.3e-33 43.6 94/96  
:HMM:PFM   151->266 PF00549 * Ligase_CoA 2.2e-23 34.5 116/153  
:BLT:SWISS 1->290 SUCD_RICFE 1e-99 62.1 %
:PROS 237->250|PS00399|SUCCINYL_COA_LIG_2
:PROS 152->181|PS01216|SUCCINYL_COA_LIG_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21059.1 GT:GENE sucD GT:PRODUCT Succinyl-CoA synthetase alpha chain (SCS-alpha) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(239860..240735) GB:FROM 239860 GB:TO 240735 GB:DIRECTION - GB:GENE sucD GB:PRODUCT Succinyl-CoA synthetase alpha chain (SCS-alpha) GB:PROTEIN_ID AAZ21059.1 GB:DB_XREF GI:71062056 GB:GENE:GENE sucD LENGTH 291 SQ:AASEQ MSVLIDKNTKVICQGFTGTHGTFHSEQALKYGTNLVGGVTPKKGGQKHLDRPVFNTVAEAKQEVGADATMIYVPAKFAAAAIIEAIDASIELIVCITEGVPIQDMLRVKQKLNNSKSRLIGPNCPGIITPDECKIGIMPGNIHKKGSVGIVSRSGTLTYEAVAQTTENGLGQSTCIGIGGDPINGTNFIDCLDLFLNDAETESILMIGEIGGSAEEEAAEFVKNHKIKKPMVGFVAGITAPPGRTMGHAGAIISGGKGGAEDKIKKMEECGITIAKSPSELGKTLFNKLSN GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 1->290|SUCD_RICFE|1e-99|62.1|290/292| PROS 237->250|PS00399|SUCCINYL_COA_LIG_2|PDOC00335| PROS 152->181|PS01216|SUCCINYL_COA_LIG_1|PDOC00335| TM:NTM 1 TM:REGION 75->97| SEG 71->90|iyvpakfaaaaiieaidasi| SEG 207->220|igeiggsaeeeaae| SEG 247->260|ghagaiisggkgga| BL:PDB:NREP 1 BL:PDB:REP 5->288|2fpgA|9e-77|63.0|284/305| RP:PDB:NREP 1 RP:PDB:REP 2->285|1cqjA|4e-43|52.3|283/286| RP:PFM:NREP 2 RP:PFM:REP 9->99|PF02629|7e-09|38.5|91/95|CoA_binding| RP:PFM:REP 151->272|PF00549|1e-09|32.0|122/127|Ligase_CoA| HM:PFM:NREP 2 HM:PFM:REP 6->99|PF02629|7.3e-33|43.6|94/96|CoA_binding| HM:PFM:REP 151->266|PF00549|2.2e-23|34.5|116/153|Ligase_CoA| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00549|IPR005811| GO:PFM GO:0008152|"GO:metabolic process"|PF00549|IPR005811| RP:SCP:NREP 2 RP:SCP:REP 2->122|1cqiA1|2e-20|55.4|121/121|c.2.1.8| RP:SCP:REP 123->285|1cqiA2|8e-40|50.0|162/165|c.23.4.1| HM:SCP:REP 1->122|1eucA1|1.5e-49|50.0|122/0|c.2.1.8|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 123->290|1oi7A2|3.5e-59|41.9|167/0|c.23.4.1|1/1|Succinyl-CoA synthetase domains| OP:NHOMO 1139 OP:NHOMOORG 919 OP:PATTERN 111111111111111111111112111111111111111111111111-----1-------1111-11 111111-1111---11111-11111111111111111111111111111111111111--111111122111111111----122122111------11111111111111111111111111112222222222211111---11-11-111----------11--1111------------11111---1111111111111111111111111111111111------1111111111111111111111-----------------------------------------------------------------------11-------------------------1--1-33--1--111-------1-1111111111121111131111211111111111-332222221211111111211111121112111111312--------111-2111111111111111111111111111111111111111111111111111111111311111111111121111122111111121111111111111111122211111111111-11111-32313141111211121--11111111----------21212111111111111111111111111111111111111111------21111111112122211-11111221111211111121111111111111111111111111111111111111111111111111111111111121111111111-111-11111111111111111111111111111111111111111111111111111111111111111111111111-111111------------------------------------1---1-1---111 11--111-421-1112232222222222222222231111122222222233231122222221111111111111111111111112-24222111111213322-22121711111111111111113A1-1111111111121111111121111233712112213144322111H1111131253211121111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 288 STR:RPRED 99.0 SQ:SECSTR ccccccTTcEEEEETTTcHHHHHHHHHHHHHTcEEEEEEcTTcTTEEETTEEEEccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHTccEEEEccccccHHHHHHHHHHHHHTTcEEEcccccEEEETTTEEEEcccGGGccEEEEEEEEccHHHHHHHHHHHHHTcccEEEEEEccccccccccHHHHHHHHHTcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEcTTccTTcccccTTccccTTcccHHHHHHHHHHTccEEcccGGGHHHHHHHH### PSIPRED cccccccccEEEEEccccccHHHHHHHHHHccccEEEEccccccccEEccEEccccHHHHHccccccEEEEEccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEccccccEEcccccccccccccccccccEEEEEEccHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHHcccEEcccHHHHHHHHHHHHcc //