[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : sufA
DDBJ      :sufA         Transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  547/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.49.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   25->74 2b0lA PDBj 8e-05 16.0 %
:RPS:SCOP  11->92 1f6vA  a.49.1.1 * 5e-13 6.9 %
:HMM:SCOP  2->138 1ylfA1 a.4.5.55 * 6.8e-32 34.1 %
:RPS:PFM   1->83 PF02082 * Rrf2 9e-15 44.6 %
:HMM:PFM   1->83 PF02082 * Rrf2 1.1e-28 50.6 83/83  
:HMM:PFM   84->117 PF00214 * Calc_CGRP_IAPP 0.00033 31.2 32/130  
:BLT:SWISS 1->135 ISCR_EDWI9 9e-33 49.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21557.1 GT:GENE sufA GT:PRODUCT Transcriptional regulator GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 722560..722985 GB:FROM 722560 GB:TO 722985 GB:DIRECTION + GB:GENE sufA GB:PRODUCT Transcriptional regulator GB:PROTEIN_ID AAZ21557.1 GB:DB_XREF GI:71062554 GB:GENE:GENE sufA LENGTH 141 SQ:AASEQ MKLTSKGRYAVMALADLAKFNSVNPVSLRDISLRQGISLDFLEQIFSKLKKYNIVKSIRGTNGGYILNKEPEEIKLANILSAVDEEVKTVQCKKESKKGCNSKTTKCITHNLWDELEVHINHFFEQKNLKDLISNSSESRN GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 1->135|ISCR_EDWI9|9e-33|49.2|132/165| RP:PDB:NREP 1 RP:PDB:REP 25->74|2b0lA|8e-05|16.0|50/98| RP:PFM:NREP 1 RP:PFM:REP 1->83|PF02082|9e-15|44.6|83/83|Rrf2| HM:PFM:NREP 2 HM:PFM:REP 1->83|PF02082|1.1e-28|50.6|83/83|Rrf2| HM:PFM:REP 84->117|PF00214|0.00033|31.2|32/130|Calc_CGRP_IAPP| RP:SCP:NREP 1 RP:SCP:REP 11->92|1f6vA|5e-13|6.9|72/91|a.49.1.1| HM:SCP:REP 2->138|1ylfA1|6.8e-32|34.1|135/0|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 701 OP:NHOMOORG 547 OP:PATTERN -------------------------------------------------------------------- -1211-----------111-11--111111111111------1------------------------1----------122311---------------------1---1---------------1----2---1-1111-11-1121231111122------11223231------------1111122-21122222222121121112222112121111111111112211111111111111-11111----------------------------------------------------------------------11134333324213121111111235111112122212-12311112-1-1--1111------------------1111-1--112---1------12-222122122222--1-11122322111-------------1221111122211111111-1111-11-----1--1--11111111111111111111111111111111111111111221212111111111111111111112111---1-225243444-242234322--1--11-31-11---------------2111-11111111111111111111111111111111---2112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------1111111111111111111111222111111111111111111111111111111111111111111111111--------------112-------------------------------------------1-2--212121-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 61 STR:RPRED 43.3 SQ:SECSTR #############HHHHHHTcTTcEEcHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccccEEEEEccHHH################################################################### DISOP:02AL 1-2, 137-141| PSIPRED cccccHHHHHHHHHHHHHHcccccEEcHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccc //