[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : sufE
DDBJ      :sufE         Putative nifU-like protein
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  324/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.224.1
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->143 2qq4F PDBj 3e-23 41.0 %
:RPS:PDB   1->102 2e5aA PDBj 9e-09 9.9 %
:HMM:SCOP  1->150 1xjsA_ d.224.1.2 * 7.9e-45 43.4 %
:RPS:PFM   6->77 PF01592 * NifU_N 9e-16 50.7 %
:HMM:PFM   7->131 PF01592 * NifU_N 7.9e-25 29.5 122/127  
:BLT:SWISS 2->139 NIFU_BACSU 3e-20 41.2 %
:PROS 23->37|PS00066|HMG_COA_REDUCTASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21562.1 GT:GENE sufE GT:PRODUCT Putative nifU-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 727622..728092 GB:FROM 727622 GB:TO 728092 GB:DIRECTION + GB:GENE sufE GB:PRODUCT Putative nifU-like protein GB:NOTE involved in Fe-S cluster formation GB:PROTEIN_ID AAZ21562.1 GB:DB_XREF GI:71062559 GB:GENE:GENE sufE LENGTH 156 SQ:AASEQ MNIKELYQEIILEHGKNPRNLRKTENFNKDAMGKNPLCGDNVHIFLKLDENKKVEDISFEGSGCAISMASASIMTDLIKGKEEVEVKEIVNDFLGMIKENPELKSKNLEEDEKTKLMCLSGVKQYPMRVKCATLSWHTLISAIDNTQEEINTEKLD GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 2->139|NIFU_BACSU|3e-20|41.2|131/147| PROS 23->37|PS00066|HMG_COA_REDUCTASE_1|PDOC00064| SEG 78->90|ikgkeevevkeiv| BL:PDB:NREP 1 BL:PDB:REP 3->143|2qq4F|3e-23|41.0|134/136| RP:PDB:NREP 1 RP:PDB:REP 1->102|2e5aA|9e-09|9.9|101/329| RP:PFM:NREP 1 RP:PFM:REP 6->77|PF01592|9e-16|50.7|71/126|NifU_N| HM:PFM:NREP 1 HM:PFM:REP 7->131|PF01592|7.9e-25|29.5|122/127|NifU_N| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01592|IPR002871| GO:PFM GO:0016226|"GO:iron-sulfur cluster assembly"|PF01592|IPR002871| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF01592|IPR002871| HM:SCP:REP 1->150|1xjsA_|7.9e-45|43.4|143/0|d.224.1.2|1/1|SufE/NifU| OP:NHOMO 353 OP:NHOMOORG 343 OP:PATTERN -----------------------21111111111---------11-1--1111-------------1- --11111111111111111-1111111111111111111111111-111111111--1--11111111111111111111112-----------------------------------------------------11121---121--111-1111--------11-------------------1111-111111111111111111122211111111111111111111111111111111111111111--11111-1111111111111111111111111111111111111111111111111111111111111---111111111-1---11111111-1111-----1---11--221-1-12-1---------------------------------------------------------------------------------111-1-1------------------------------1-----------------1111----111111-----1---------11--11-------1----------111-------------------------1-11111-1--------------------------------------1---------------------111-----------------------------------------------------------------------------------------------1111111111--------------------------------------------------------------------------------------------1111--------111111-----------------------11111111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 91.7 SQ:SECSTR TTTcTTHHHHHHHHHcHHHHTTTcccEEEEEEEEEEccEEEEEEEEEEcETTEEEEEEEEccTTTccHHHHHHHHHHHTTccccccTTTccHHHHHHHHHHHccccccccGGGGGGGGGGGGGGcTTcHHHHHHHHHHHHHHT############# DISOP:02AL 147-156| PSIPRED ccHHHHHHHHHHHHHHccccccccccccEEEEEcccccccEEEEEEEEccccEEEEEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //