[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : suhB
DDBJ      :suhB         extragenic suppressor protein suhB
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  723/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
e.7.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->243 2qflA PDBj 6e-40 36.9 %
:RPS:PDB   8->245 1awbA PDBj 1e-39 26.6 %
:RPS:SCOP  8->246 1awbA  e.7.1.1 * 1e-44 25.6 %
:HMM:SCOP  1->245 1jp4A_ e.7.1.1 * 1.2e-74 40.8 %
:RPS:PFM   8->219 PF00459 * Inositol_P 4e-37 40.1 %
:HMM:PFM   10->221 PF00459 * Inositol_P 6.3e-56 37.9 211/272  
:BLT:SWISS 5->244 SUHB_RHILO 7e-54 46.4 %
:PROS 84->97|PS00629|IMP_1
:PROS 199->213|PS00630|IMP_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21402.1 GT:GENE suhB GT:PRODUCT extragenic suppressor protein suhB GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(569619..570359) GB:FROM 569619 GB:TO 570359 GB:DIRECTION - GB:GENE suhB GB:PRODUCT extragenic suppressor protein suhB GB:PROTEIN_ID AAZ21402.1 GB:DB_XREF GI:71062399 GB:GENE:GENE suhB LENGTH 246 SQ:AASEQ MQSISANLNVMIKAAEKASRALIRDFGEIEKLQVSIKGPTDFVSNADLKAEKIIIEELKKARPYYSIISEEEGSETNKDKEHTWIIDPIDGTTNFLHGVPHFAISIALKSGDEIVSGLIYDPIKDEMFYAEKESGAFFNNQRIRVSKKRELNSCLFATGGITKNEVDLPLRKSGSAALDIAYVAAGRYDGYFQNDLNLWDIAAGIILVKEAGGLINEIDLSQNKNIKIRASSMAINDKMLEKLKNF GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 5->244|SUHB_RHILO|7e-54|46.4|239/266| PROS 84->97|PS00629|IMP_1|PDOC00547| PROS 199->213|PS00630|IMP_2|PDOC00547| SEG 48->61|lkaekiiieelkka| SEG 66->75|siiseeegse| BL:PDB:NREP 1 BL:PDB:REP 8->243|2qflA|6e-40|36.9|233/262| RP:PDB:NREP 1 RP:PDB:REP 8->245|1awbA|1e-39|26.6|237/272| RP:PFM:NREP 1 RP:PFM:REP 8->219|PF00459|4e-37|40.1|212/257|Inositol_P| HM:PFM:NREP 1 HM:PFM:REP 10->221|PF00459|6.3e-56|37.9|211/272|Inositol_P| GO:PFM:NREP 1 GO:PFM GO:0004437|"GO:inositol or phosphatidylinositol phosphatase activity"|PF00459|IPR000760| RP:SCP:NREP 1 RP:SCP:REP 8->246|1awbA|1e-44|25.6|238/272|e.7.1.1| HM:SCP:REP 1->245|1jp4A_|1.2e-74|40.8|240/304|e.7.1.1|1/1|Carbohydrate phosphatase| OP:NHOMO 1468 OP:NHOMOORG 893 OP:PATTERN ----------------1--1---11112111-111111----11111111111-1111111---1--2 1121324311112211111-1---311111121-1-11112111-11221111-1--2--221-3314331-----------3111111111-1-----------32121--------------11213222222232233---3122222221111222131222322223223222223221111111-21111111111111111-11111111111111111111113111111111111111-122221-1----1---1111--1-111-111111----11111111111111-------------111111111----------------1-------------------------------2--223322311112323333222323255555545555-213323321531866668377776312212222222322222222221222222111111111----112221111111111112333123333311111111111111111111111112111111121111111121112211222222222222322111-1-121111112-11111111111112-1211-11111111-1---------11-221212212222122222213222232322221-23113111111113211111-1111111-1111111111111111111333112111111111111111111211111111121111111111111111111111113132622213121111222111111111112111111121111112122111111111221222222222222111111111111111221224433111----------------------------------311112111121 ----1---211-111-112---11-1---1111--1--1--------111------11----1-1--11-11---111111-----1--12-1-1-11-1-11111-17164544231-2212-321324E2-224-2112222-111-121-31232312112121622B2211221272212262552233431112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 100.0 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHHHHHTTccccccEEcccTTcEEcHHHHHHHHHHHHHHHHHcTTcEEEEHHHHHHcccccccEEEEEEEEcHHHHHHTccccEEEEEEEETTEEEEEEEEETTTTEEEEEETTTEEEETTEEccccccccGGGcEEEccHHHHHHHHcEEEccccHHHHHHHHHHTcccEEEEEcccHHHHHHHHHHHHHTTcEEEcTTccTTccEEEEEccHHHHHHHHHHcccc DISOP:02AL 1-2, 31-33, 141-154| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccEEEEEEcccccHHHHHcccEEEEEEEEEEccEEEEEEEEEcccccEEEEEcccccEEccEEcccccccccccEEEEEEccccccccccEEEEcHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHcccEEEEcccccccccEEEEccHHHHHHHHHHHHcc //