[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : thyX
DDBJ      :thyX         thymidylate synthase-complementing family protein (Pfam)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  104/915 : Eukaryota  2/199 : Viruses  7/175   --->[See Alignment]
d.207.1
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   69->298 1o28A PDBj 1e-47 47.8 %
:RPS:PDB   69->303 2af6C PDBj 7e-53 18.4 %
:RPS:SCOP  63->298 1kq4A  d.207.1.1 * 2e-39 43.5 %
:HMM:SCOP  63->301 1kq4A_ d.207.1.1 * 6.9e-65 40.7 %
:RPS:PFM   86->285 PF02511 * Thy1 5e-23 41.5 %
:HMM:PFM   74->286 PF02511 * Thy1 6.2e-60 38.0 184/188  
:HMM:PFM   53->80 PF11182 * AlgF 0.0007 46.4 28/180  
:BLT:SWISS 30->332 THYX_SILPO e-108 63.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20835.1 GT:GENE thyX GT:PRODUCT thymidylate synthase-complementing family protein (Pfam) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(9267..10301) GB:FROM 9267 GB:TO 10301 GB:DIRECTION - GB:GENE thyX GB:PRODUCT thymidylate synthase-complementing family protein (Pfam) GB:PROTEIN_ID AAZ20835.1 GB:DB_XREF GI:71061832 GB:GENE:GENE thyX LENGTH 344 SQ:AASEQ MVITKFVYRRSWQANTITIKAFERDSIKIMKLTKEQSQEIKDQQGQQNQTKRVTAPALENILYEAMPALDHGFVRVIDYMGDDTSIVQSARVSYGKGTKQVSTDAGLIKYLMRHWHSTPFEMCEIKYHVKLPIFIARQWIRHRTANVNEYSARYSILDKEFYLPSAENLAAQSSSNRQGRGDVIEGEQAKEVLELLKNDAEQTYDNYEMMLNQRFDGSTIDENKKGLARELARMNLTLNTYTQWYWKTDLLNLMNFLRLRADSHAQYEIRVYADIMLDTVKKWVPITYDAFMDYRVGGTEVSAKGKIIIQKLIKGEDVNPDSSGLSKREWNELMVSFDLKDKLI GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 30->332|THYX_SILPO|e-108|63.4|295/302| SEG 304->315|kgkiiiqklikg| BL:PDB:NREP 1 BL:PDB:REP 69->298|1o28A|1e-47|47.8|207/218| RP:PDB:NREP 1 RP:PDB:REP 69->303|2af6C|7e-53|18.4|217/238| RP:PFM:NREP 1 RP:PFM:REP 86->285|PF02511|5e-23|41.5|171/183|Thy1| HM:PFM:NREP 2 HM:PFM:REP 74->286|PF02511|6.2e-60|38.0|184/188|Thy1| HM:PFM:REP 53->80|PF11182|0.0007|46.4|28/180|AlgF| GO:PFM:NREP 3 GO:PFM GO:0006231|"GO:dTMP biosynthetic process"|PF02511|IPR003669| GO:PFM GO:0050660|"GO:FAD binding"|PF02511|IPR003669| GO:PFM GO:0050797|"GO:thymidylate synthase (FAD) activity"|PF02511|IPR003669| RP:SCP:NREP 1 RP:SCP:REP 63->298|1kq4A|2e-39|43.5|200/203|d.207.1.1| HM:SCP:REP 63->301|1kq4A_|6.9e-65|40.7|216/216|d.207.1.1|1/1|Thymidylate synthase-complementing protein Thy1| OP:NHOMO 114 OP:NHOMOORG 113 OP:PATTERN -------------------------------------------------------------------- ----1-----------------------------------1--------11-------11-------111-------------1-----------------------------------------1111-111111------------------------------1----111----11----1-11--1------------------------------------------1---------------------------------------------------------------------------------------------------------------1---------------------------------------1---------------------------------------------1--1----111------11111111111111---111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11----1111--2-11--------------------------1111111111--- ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----1--------1--------11-----------------------1------------------1-------------------------------------------------------------------------------------------------------1--- STR:NPRED 240 STR:RPRED 69.8 SQ:SECSTR #############################################################EEEEcccccTTccccccccHHHHHHHHHHHHTTTccccccTTcccHHHHHHHHTcGGGGGGcEEEEEEEEEHHHHHHHTTcTTcEEEEccTTTcccTTcccccHcGGTTcHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHTTTcccHHHHHHH##HHHHHHTTcHHHHHGGGGcTTcEEEEEEEEEHHHHHHHHHHHccTTccHHHHHHHHHHHHHHHHHcHHHHTTcEEEEcTTccEEE######################################### DISOP:02AL 36-47| PSIPRED cccHHHHHHccccccEEEEEEEccccEEEEEccHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHcccEEEEEEEcccHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccEEEEEEEEEEEEccHHHHHHHHHcEEEEEEEEEEEEEEcccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccHHHHHHHccccccEEEEEEEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHHHHHHcc //