[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : tktC
DDBJ      :tktC         transketolase family
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  540/915 : Eukaryota  46/199 : Viruses  0/175   --->[See Alignment]
c.36.1c.48.1
:309 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   46->297 2o1xD PDBj 1e-12 23.8 %
:RPS:PDB   45->300 2bfcB PDBj 2e-28 13.4 %
:RPS:SCOP  45->166 1dtwB1  c.36.1.7 * 5e-20 16.4 %
:RPS:SCOP  188->300 1dtwB2  c.48.1.2 * 1e-13 12.7 %
:HMM:SCOP  1->166 1r9jA1 c.36.1.6 * 1.3e-41 32.9 %
:HMM:SCOP  169->306 1qs0B2 c.48.1.2 * 4.9e-19 30.3 %
:RPS:PFM   46->155 PF02779 * Transket_pyr 5e-12 36.7 %
:RPS:PFM   188->249 PF02780 * Transketolase_C 8e-06 29.0 %
:HMM:PFM   1->160 PF02779 * Transket_pyr 1.3e-24 25.2 159/178  
:HMM:PFM   176->296 PF02780 * Transketolase_C 2.3e-18 26.7 120/124  
:BLT:SWISS 46->304 DXS_CLOD6 3e-24 27.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21357.1 GT:GENE tktC GT:PRODUCT transketolase family GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(529658..530587) GB:FROM 529658 GB:TO 530587 GB:DIRECTION - GB:GENE tktC GB:PRODUCT transketolase family GB:PROTEIN_ID AAZ21357.1 GB:DB_XREF GI:71062354 GB:GENE:GENE tktC LENGTH 309 SQ:AASEQ MRNTFARVITKITKKNKKIILLAGDIGNKLFDDFKNKFPKNFYNCGVAESNMTTVAAGLAYNGYQPITYTITSFNTLKTIEQIKLDICYQNLPVIIVGVGSGLSYSNLGTTHHSIEDIGMLMNIPKLNIFAPADQQELEILLPQIIKQKKPAYLRIGKKNERTVYNSYKCKSKIGKITQIIKGKNICILGYGNILRNCLDALDELSKKINPSIYNVHTLKPINKKQIKEILKKYHKILIVEEHYKHGGLYNLVSEIKVNQRIKDNVILSLNAGEDYIIGSGDIKNTHKKLGLDKNAIVKKMNFLNKLKC GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 46->304|DXS_CLOD6|3e-24|27.8|255/621| SEG 9->20|itkitkknkkii| SEG 28->44|nklfddfknkfpknfyn| SEG 171->186|kskigkitqiikgkni| BL:PDB:NREP 1 BL:PDB:REP 46->297|2o1xD|1e-12|23.8|244/530| RP:PDB:NREP 1 RP:PDB:REP 45->300|2bfcB|2e-28|13.4|253/332| RP:PFM:NREP 2 RP:PFM:REP 46->155|PF02779|5e-12|36.7|109/172|Transket_pyr| RP:PFM:REP 188->249|PF02780|8e-06|29.0|62/122|Transketolase_C| HM:PFM:NREP 2 HM:PFM:REP 1->160|PF02779|1.3e-24|25.2|159/178|Transket_pyr| HM:PFM:REP 176->296|PF02780|2.3e-18|26.7|120/124|Transketolase_C| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF02780|IPR005476| GO:PFM GO:0008152|"GO:metabolic process"|PF02780|IPR005476| RP:SCP:NREP 2 RP:SCP:REP 45->166|1dtwB1|5e-20|16.4|122/188|c.36.1.7| RP:SCP:REP 188->300|1dtwB2|1e-13|12.7|110/138|c.48.1.2| HM:SCP:REP 1->166|1r9jA1|1.3e-41|32.9|164/0|c.36.1.6|1/1|Thiamin diphosphate-binding fold (THDP-binding)| HM:SCP:REP 169->306|1qs0B2|4.9e-19|30.3|132/134|c.48.1.2|1/1|TK C-terminal domain-like| OP:NHOMO 916 OP:NHOMOORG 624 OP:PATTERN 11-1--1111111111-111111------1-----11111111-----------11-111-111--11 113-1-1------------------1----------1-21---1--------112---111-1-2-2--1--------3111-1112211-1-111--1112232123-311111111--1111122122222232-----111-2111111211111111111111111121211211111111111111--111111111-11111111221-111111--1--221-1-11--------------------1-----1--111--1--1-------111--11---11111111111-------------------111121224222222242313222222-13--2242222211212213212-32-31-----------333-1--2--1----------1-1111121111--111-12111111-3-1-----122-----------11---1-------------------------------2-----1----422122222222221222212111121111111211111121211-11--1--1111111111111-212111111311113443333121111--111--2-11112----------1----11--2---1-111-1-----1-----------1--2--11-----21221311111111111-11111111111111111132222111-32222222222222221111111111221222222222--11----------11-11112211111111112222211----1------22---11-211111111111--11111111-1-----11111111-----132111122--------11-------------------1------1221-13-2111- --------------------------------------------------------------------------------------------------------------1121-11----23132241AU3-434-1-13-14-----221-2-1111---1--1-3-16--1------1-1--3112----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 83.8 SQ:SECSTR ############################################ccccHHHHHHHHHHHHHTTccEEEEcccGGGcGGGHHHHHTTGGGTccccTTEEEEEEEccccccHHHHcccTHHHHHTcTTcEEEccccHHHHHHHHHHHHHccccEEEEEEGGGTTcccEEEcccccTTccEEEEccccEEEEEcTTHHHHHHHHHHHHHHHccEEEEEccEEEcccHHHHHHHHHHHccEEEEEEEEcTTcHHHHHHHHHHHHHGGGcccccEEEEEcccccccTTEEEHHHHcccHHHHHHHGcc###### PSIPRED cHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHccccEEEccccHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHcccHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccEEEEEEccccEEEEEccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHcccccccEEEEEEcccEEcccccHHHHHHHHcccHHHHHHHHHHHHHccc //