[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : tolA
DDBJ      :tolA         TolA protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.212.1
:269 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  169->266 1lr0A  d.212.1.1 * 7e-07 19.3 %
:HMM:SCOP  51->264 1lr0A_ d.212.1.1 * 0.00063 23.2 %
:HMM:PFM   80->131 PF04089 * BRICHOS 0.0008 17.6 51/97  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21417.1 GT:GENE tolA GT:PRODUCT TolA protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 581234..582043 GB:FROM 581234 GB:TO 582043 GB:DIRECTION + GB:GENE tolA GB:PRODUCT TolA protein GB:PROTEIN_ID AAZ21417.1 GB:DB_XREF GI:71062414 GB:GENE:GENE tolA LENGTH 269 SQ:AASEQ MNRNIVISFGLHIFLVVITAMSLPFLAKKPIDLPPIISVELIQITDKTNIPFAPKAKKIIEKVKEKEKKLVSEQAPPKKIKKQKPDAVPLPDEKIEKIKKIKDEKQNPEKEETEIKQISEFEKKELFDTNSIAALIDKSKTESAETNKKSNKVTQDQDKDMDFSGLTLSEEDALKAQIFGCWSIPLGLPFNEDLLVRIKLQLKPDGSIIKTEILDHARMNRPGQGFYKVLAESALRAIKLCQPLRVPSTGYERWKDMQLNFDAREMLEG GT:EXON 1|1-269:0| SEG 55->69|kakkiiekvkekekk| SEG 76->85|ppkkikkqkp| SEG 92->105|dekiekikkikdek| HM:PFM:NREP 1 HM:PFM:REP 80->131|PF04089|0.0008|17.6|51/97|BRICHOS| RP:SCP:NREP 1 RP:SCP:REP 169->266|1lr0A|7e-07|19.3|88/126|d.212.1.1| HM:SCP:REP 51->264|1lr0A_|0.00063|23.2|112/126|d.212.1.1|1/1|TolA/TonB C-terminal domain| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1111111111-----------11-----1---1---1------------------------------111--------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-168, 215-221| PSIPRED cccEEEHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEEEEEEEcccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHccccEEEEEEccHHHHcc //