[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : tolR
DDBJ      :tolR         tolR protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  467/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:138 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->133 2pfuA PDBj 6e-10 26.4 %
:RPS:PFM   15->133 PF02472 * ExbD 7e-17 40.3 %
:HMM:PFM   10->132 PF02472 * ExbD 1.7e-31 31.7 123/130  
:BLT:SWISS 7->133 TOLR_PSEAE 8e-24 40.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21416.1 GT:GENE tolR GT:PRODUCT tolR protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 580812..581228 GB:FROM 580812 GB:TO 581228 GB:DIRECTION + GB:GENE tolR GB:PRODUCT tolR protein GB:PROTEIN_ID AAZ21416.1 GB:DB_XREF GI:71062413 GB:GENE:GENE tolR LENGTH 138 SQ:AASEQ MAFNLKRSSKEPMSEINVTPFVDVMLVLLIIFMVTAPLLTVGIQVDLPESSADSLPEELEPLTLSINSKGEIFIQESKVEYDKIIAKILAVSKNRTDTRIYVRGDKSINYGRVLEIMGMLSGSGFTKVALISEPYKER GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 7->133|TOLR_PSEAE|8e-24|40.9|127/146| TM:NTM 1 TM:REGION 20->42| SEG 55->62|lpeelepl| BL:PDB:NREP 1 BL:PDB:REP 43->133|2pfuA|6e-10|26.4|91/99| RP:PFM:NREP 1 RP:PFM:REP 15->133|PF02472|7e-17|40.3|119/127|ExbD| HM:PFM:NREP 1 HM:PFM:REP 10->132|PF02472|1.7e-31|31.7|123/130|ExbD| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF02472|IPR003400| GO:PFM GO:0006810|"GO:transport"|PF02472|IPR003400| GO:PFM GO:0016020|"GO:membrane"|PF02472|IPR003400| OP:NHOMO 890 OP:NHOMOORG 468 OP:PATTERN -------------------------------------------------------------------- 221--------------------------------------------------------------------------------------------------------------------------111211111-1------------------------------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21-433322222543545527645522222222222-22422232123-122211211122221111122222111666666661223213211--------111111111111111----113122222223455636333333433333238581211121-1533333335312424533221111111222152111111113112211111121112113121111122122111111111111112--111222111321111111111111111111111--11112------1111-111111111111-1111111111111111111111331111111111111111111111111111-211111111111---2111111111311111111-------2---3333344232633333355422323255511111111113221222221121144334343333323111-111111----------------------------------------------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 91 STR:RPRED 65.9 SQ:SECSTR ##########################################ccccccccccccccccccccEEEEETTTEEEETTEEEccccHHHHHHHHccccccccEEEEEcTTccHHHHHHHHHHHHHTccccEEcTTc##### DISOP:02AL 1-17, 46-63, 135-138| PSIPRED cccccccccccccHHcccccHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccEEEEEcccccEEEccEEccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEEcccccc //