[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : trmE
DDBJ      :trmE         tRNA modification GTPase
Swiss-Prot:MNME_PELUB   RecName: Full=tRNA modification GTPase mnmE;         EC=3.6.-.-;

Homologs  Archaea  5/68 : Bacteria  855/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
a.118.1a.24.25b.34.4d.250.1
:443 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->443 1xzqA PDBj 2e-52 33.8 %
:RPS:PDB   64->356 2e87A PDBj 1e-21 10.6 %
:RPS:SCOP  2->118 1xzpA3  d.250.1.2 * 1e-33 43.0 %
:RPS:SCOP  117->303 1ahjB  b.34.4.4 * 2e-23 8.2 %
:RPS:SCOP  318->440 2iolA1  a.118.1.14 * 4e-10 12.5 %
:HMM:SCOP  2->118 1xzpA3 d.250.1.2 * 7.2e-32 43.5 %
:HMM:SCOP  119->443 1xzpA1 a.24.25.1 * 1.9e-53 43.4 %
:RPS:PFM   2->118 PF10396 * TrmE_N 4e-23 49.6 %
:RPS:PFM   221->292 PF05879 * RHD3 6e-04 33.3 %
:HMM:PFM   2->118 PF10396 * TrmE_N 1.7e-39 46.1 115/115  
:HMM:PFM   226->326 PF01926 * MMR_HSR1 2.3e-22 34.7 101/108  
:BLT:SWISS 1->443 MNME_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21172.1 GT:GENE trmE GT:PRODUCT tRNA modification GTPase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 341586..342917 GB:FROM 341586 GB:TO 342917 GB:DIRECTION + GB:GENE trmE GB:PRODUCT tRNA modification GTPase GB:PROTEIN_ID AAZ21172.1 GB:DB_XREF GI:71062169 GB:GENE:GENE trmE LENGTH 443 SQ:AASEQ MTIYALSTGPGISGIAIVRVSGKDTKKVIKLLTNAALPETRVATLRKINKINTSELIDEGIILWFPGPESYTGEDMAEFHIHGSKAVIDALHHSISKIKNCRLADPGEFTKLAFQNGKINLLKAESIADLISAETEIQRQQAIKIMNGKSADKFNNLREKLLKILSHVEAKIDFPDEDLPEDILKNIKKISNEVILNIKKILDDQKVGERIREGFKIAIIGPTNAGKSSLLNHLSNRDVAIVSEIAGTTRDVIETHLNIDGYPVVVSDTAGIRDSKNEIEKKGIKLALDKADNADLKLIVIDAKSIDFKGVLKELMDENAILVINKSDLLNKDLNSEIKNYEHVLISVKNNLNLEDLISKIKNKLKNKFITSEDILITRARHRQHLEQSLNCLKNFEEKNEAEDFDKAAEDLRLATRHLGMIVGKVDVEEILGSIFNDFCIGK GT:EXON 1|1-443:0| SW:ID MNME_PELUB SW:DE RecName: Full=tRNA modification GTPase mnmE; EC=3.6.-.-; SW:GN Name=mnmE; Synonyms=trmE; OrderedLocusNames=SAR11_0350; SW:KW Complete proteome; Cytoplasm; GTP-binding; Hydrolase; Magnesium;Metal-binding; Nucleotide-binding; Potassium; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->443|MNME_PELUB|0.0|100.0|443/443| GO:SWS:NREP 6 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 357->368|liskiknklknk| BL:PDB:NREP 1 BL:PDB:REP 2->443|1xzqA|2e-52|33.8|429/449| RP:PDB:NREP 1 RP:PDB:REP 64->356|2e87A|1e-21|10.6|283/353| RP:PFM:NREP 2 RP:PFM:REP 2->118|PF10396|4e-23|49.6|115/117|TrmE_N| RP:PFM:REP 221->292|PF05879|6e-04|33.3|72/690|RHD3| HM:PFM:NREP 2 HM:PFM:REP 2->118|PF10396|1.7e-39|46.1|115/115|TrmE_N| HM:PFM:REP 226->326|PF01926|2.3e-22|34.7|101/108|MMR_HSR1| RP:SCP:NREP 3 RP:SCP:REP 2->118|1xzpA3|1e-33|43.0|114/117|d.250.1.2| RP:SCP:REP 117->303|1ahjB|2e-23|8.2|184/212|b.34.4.4| RP:SCP:REP 318->440|2iolA1|4e-10|12.5|112/127|a.118.1.14| HM:SCP:REP 2->118|1xzpA3|7.2e-32|43.5|115/0|d.250.1.2|1/1|Folate-binding domain| HM:SCP:REP 119->443|1xzpA1|1.9e-53|43.4|173/0|a.24.25.1|1/1|TrmE connector domain| OP:NHOMO 1940 OP:NHOMOORG 1029 OP:PATTERN -----------------------------------11-----1----------1---1---------- 222---1--------------1---1------1------------111-----1--1-----1----1-1-1-111112122122224332322222113222223222211111112222222122222222222222331112123322222233221123321122231131112111222222222223222222222222222223224222233312333333333233333331333333333323322333323232233333222222222222222222222222222222222222223222222223222244343444444434345443333244322243422444333245544333133111112222113322222321322222222211-1112112122232112332333222121121111111211111111112231212223333331212222222222222222231222112222111111121111222211111111222222211111111111111222113111111111111212233323124324333223333334311112133223222222232222222222222211222222222112222222233222222222112222211211122222222222222222-22222222222222222222222222222221122112222222222222221222222222222112211111111111122222222222222222111111122222222222221222222221111111111222222222222221111111111112122232222222221221222121223-33322212222222222214344323222222 11--221-1------11111111111111111111111111111111111111121111111111111111111111-1111111111-1311111----111121-1212111113-11-11121111292-112-1111111-111-111121---113-1-11-111311112114M333231112112-22-322 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 439 STR:RPRED 99.1 SQ:SECSTR #cEEEEcccccccccccEEEEccTHHHHHTTEEccccccTTccEEEEEEc##cccEEEEEEEETTTTcccccHHHHHHHHHHHHHHHHHTcccEEEEETTTEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTHHHHHHHHHHGGcccccccccEEEEEccTTccHHHHHHHHcccccEEEccTTccccEEEEEEEETTEEEEEEEcTTTcccccTTccHHHHHHHHGGGGTccEEEEEEcTTcTTcccHHHHHHHHHHEEEEccTTTccHHHHHHHHTcccEEccTTTTcTHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHH#HHHHHHHHHHccccTTccHHHHHHHHHTccccHHHHHHHHHTcccTc DISOP:02AL 201-212| PSIPRED cEEEEEEcccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEEEEccccEEEEEEEEEEEcccccEEcccEEEEEEccHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccccccccccccccccEEEEEEEccEEEEEEEcccEEccccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHcccEEEEEEccccccHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccEEcccccHHHHHHHHHHccccc //