[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : trpG
DDBJ      :trpG         Anthranilate synthase component II (Glutamine amido-transferase)
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  751/915 : Eukaryota  113/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->184 1i7qB PDBj 6e-16 29.1 %
:RPS:PDB   2->185 2a9vB PDBj 1e-20 21.1 %
:RPS:SCOP  1->183 1qdlB  c.23.16.1 * 2e-19 28.2 %
:HMM:SCOP  1->186 1qdlB_ c.23.16.1 * 9.7e-36 30.4 %
:RPS:PFM   4->175 PF00117 * GATase 2e-11 28.8 %
:HMM:PFM   4->182 PF00117 * GATase 6.6e-41 29.6 179/192  
:BLT:SWISS 1->184 TRPG_LACLA 4e-28 38.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21649.1 GT:GENE trpG GT:PRODUCT Anthranilate synthase component II (Glutamine amido-transferase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 802906..803463 GB:FROM 802906 GB:TO 803463 GB:DIRECTION + GB:GENE trpG GB:PRODUCT Anthranilate synthase component II (Glutamine amido-transferase) GB:PROTEIN_ID AAZ21649.1 GB:DB_XREF GI:71062646 GB:GENE:GENE trpG LENGTH 185 SQ:AASEQ MIYIIDHHDSFTQNVVHQFQNFDEVVCTNFNEINQNKLKKADIIVFSPGPGAPKDYPISSEIYKKFKGKKKIIGICLGFQQILHCENGKIVEQKKIYHGFQSKIKVTSKNSLFKKNSQFTVGRYHSLKLKEPFAAKNFEITMRCAISNTAMTIENNKEKIFGFQFHPESFLTENGNLLIKKILSA GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 1->184|TRPG_LACLA|4e-28|38.0|184/198| SEG 62->75|iykkfkgkkkiigi| BL:PDB:NREP 1 BL:PDB:REP 2->184|1i7qB|6e-16|29.1|179/192| RP:PDB:NREP 1 RP:PDB:REP 2->185|2a9vB|1e-20|21.1|180/195| RP:PFM:NREP 1 RP:PFM:REP 4->175|PF00117|2e-11|28.8|170/185|GATase| HM:PFM:NREP 1 HM:PFM:REP 4->182|PF00117|6.6e-41|29.6|179/192|GATase| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 1 RP:SCP:REP 1->183|1qdlB|2e-19|28.2|181/195|c.23.16.1| HM:SCP:REP 1->186|1qdlB_|9.7e-36|30.4|184/195|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1243 OP:NHOMOORG 917 OP:PATTERN 11----1111111111-1-111112--212221111111111111111-1111111--1--111--11 1111211111111111112-1-111-111111111121221-11111-11111111111111--111221111111------11111111111111-111-111111111--------------111111111111111111111111311111111111111111134311111111111111111121-11122222222122222211111122211122222222221112222222222222222222-----------11--------1-22211111111111111111111111111111111111--111----22-12----------111111111-1-111111222111--212112-111121111-----222112221121111111111111-22222222112-11111111111111121111111111111111111111-1111-----------------------------2111-211111111111211111111111111111111111111111111111211111111111111111111111-222211211111--111111111111122121111-22222112111111111111112222112222222222322222222222221-11111-1---222222222222222222-2222222222222222222222223322221222222222222222222222-221222212222221211-112222111222221221222221221111121222112222111311111111121122222112222222222222211111111111111111-221111--------------------------------------1--1-111112 ------1-----1211111-111-21111-1112211111111111111111121111111111111112111211111122222221-111111111-1--1111-12------------------------------------------------------------------1111D111112233161113212- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 185 STR:RPRED 100.0 SQ:SECSTR cEEEEEccccTTcHHHHHHHHTTccccEEETTccGGGGTTccEEEEcccccGGGGGGHHHHHHHHHHccccEEEETHHHHHHHHHTTcEEEEEEEEEEEEEEEEEEcccGGGTTcccEEEEEEEEEEEEEccHccTTEEEEEEccHcccccEEEEccccEEEEcccTTcTTcTTHHHHHHHHHHH DISOP:02AL 185-186| PSIPRED cEEEEEccccHHHHHHHHHHHcccEEEEccccccHHHHHcccEEEEccccccHHHccccHHHHHHHcccccEEEEcHHHHHHHHHcccEEEEccccEEccEEEEEEccccEEccccccEEEEEEEEEEEccccccccEEEEEEEccccEEEEEEEccccEEEEEccccccccccHHHHHHHHHcc //