[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : trxB2
DDBJ      :trxB2        thioredoxin-disulfide reductase
Swiss-Prot:FENR_PELUB   RecName: Full=Ferredoxin--NADP reductase;         Short=Fd-NADP+ reductase;         Short=FNR;         EC=1.18.1.2;

Homologs  Archaea  22/68 : Bacteria  503/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1c.4.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->301 2zbwB PDBj 8e-53 37.8 %
:RPS:PDB   3->307 3d1cA PDBj 1e-21 14.5 %
:RPS:SCOP  5->183 1djnA3  c.4.1.1 * 9e-10 20.3 %
:RPS:SCOP  157->318 1fl2A1  c.3.1.5 * 2e-15 13.9 %
:HMM:SCOP  2->315 1aogA1 c.3.1.5 * 8.7e-40 25.3 %
:HMM:PFM   5->288 PF07992 * Pyr_redox_2 2e-28 27.8 194/202  
:BLT:SWISS 1->338 FENR_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21448.1 GT:GENE trxB2 GT:PRODUCT thioredoxin-disulfide reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 615474..616490 GB:FROM 615474 GB:TO 616490 GB:DIRECTION + GB:GENE trxB2 GB:PRODUCT thioredoxin-disulfide reductase GB:PROTEIN_ID AAZ21448.1 GB:DB_XREF GI:71062445 GB:GENE:GENE trxB2 LENGTH 338 SQ:AASEQ MIKTDALIIGAGPTGLFCAHQLGLIGLNCEIVDNLDKIGGQCIELYPDKPIYDIPAVPECTGEELTNNLIKQIKPFNIKFHLNERVEEVNKVNNKWIVKTNKKKEFVTPNIIIAGGVGSFEPRKFSPKECEKYENRSLFYSIKDKTIFQDKTISIFGGGDSALDWAIELSKSSYVNLIHRRDEFTGAQLSIDKIKELEKSGKLKIYTKYQLNSVKGEQNIKSIEIKHDDESLKELETNYVLGFFGLIMKLGPIVDWGLNLDKKTIPVNTENFETNLNGIFAIGDICTYPGKLKLILSGFHEGALAARGCFKYARPDEKLRFEFTTTSKAAQERLGVKK GT:EXON 1|1-338:0| SW:ID FENR_PELUB SW:DE RecName: Full=Ferredoxin--NADP reductase; Short=Fd-NADP+ reductase; Short=FNR; EC=1.18.1.2; SW:GN OrderedLocusNames=SAR11_0627; SW:KW Complete proteome; FAD; Flavoprotein; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|FENR_PELUB|0.0|100.0|338/338| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 83->105|nerveevnkvnnkwivktnkkke| BL:PDB:NREP 1 BL:PDB:REP 4->301|2zbwB|8e-53|37.8|294/331| RP:PDB:NREP 1 RP:PDB:REP 3->307|3d1cA|1e-21|14.5|289/350| HM:PFM:NREP 1 HM:PFM:REP 5->288|PF07992|2e-28|27.8|194/202|Pyr_redox_2| RP:SCP:NREP 2 RP:SCP:REP 5->183|1djnA3|9e-10|20.3|158/233|c.4.1.1| RP:SCP:REP 157->318|1fl2A1|2e-15|13.9|158/184|c.3.1.5| HM:SCP:REP 2->315|1aogA1|8.7e-40|25.3|225/0|c.3.1.5|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 800 OP:NHOMOORG 525 OP:PATTERN --1---2322222222-1------------------1------11-1--------1----11--11-1 -1---------1---------1--1------11------1111----------1-1----111-121-----111-------1-1---111--1-----111122--1-1---------------11111222232-------1-2-------------------------------------11-111111323333333333333332333333332114333333333332333333333333332--322222222222211112222131122233322222332222222222212222222222222222222222-11122222222121-1------1111-1-1--11--111131111----1-----------1111111111111-111-111-11----------11----------------------------11111111111111111111111111111211111111111111111----------11-1--------11------11122221122111111111111-----1----------111-----1--1--1-----11111111----1----1---112222221111-1-11-11-------2-121--11-----1--------------1-----------1--1112222222222-2232222222222222222111----1222211211121212212222212-1111111111111---1-----1-11--1--111--1-111----1-------211-1----1111-1111----111111111-1---1111111-11-----------------1------11111-1--12------111-121----12111----11--11111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 337 STR:RPRED 99.7 SQ:SECSTR cccccEEEEccccTTHHHHTccTTccccccccccGGGTcGGccTcccTccHHHHHccccccHHHHHHHHHHHHHHTTcEEEccccEEEEEEccccEEEEEccccEEEEEEEEEccccTTcTTcccccccccEEGGGcccGGGHHHGGccccEEEEEcccHHHHHHHHHHHHTcEEEEEcccTTcccHHHHHHHHHHHHHTTccEEEccccEEEEEEETTEEEEEEcccccccEEEEccccEEcccccGGGcHHHHHHcccTTccccccTTccccccTTEEccTTccccccccccHHHHGGGHHHHHHHHHHHHHTcccccccEEEcccccEEEEEcc# DISOP:02AL 319-331, 336-338| PSIPRED cEEEEEEEEcccHHHHHHHHHHHHccccEEEEEcccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccccEEEEEEEEEEcccccccccccccccHHHHcccEEEEEEccHHHHcccEEEEEcccHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEEEEEcccEEEEEEEEEEEEEEEEEccHHHHHHccEEEccccEEEcccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcccccc //