[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : tyrA
DDBJ      :tyrA         prephenate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  468/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->254 3ggpC PDBj 4e-29 35.4 %
:RPS:PDB   49->258 2b0jA PDBj 2e-12 16.3 %
:RPS:SCOP  18->169 2g5cA2  c.2.1.6 * 5e-26 26.0 %
:RPS:SCOP  175->254 2g5cA1  a.100.1.12 * 2e-23 43.4 %
:HMM:SCOP  2->172 2f1kA2 c.2.1.6 * 8.9e-32 29.7 %
:HMM:SCOP  173->285 2f1kA1 a.100.1.12 * 2.5e-31 32.7 %
:RPS:PFM   50->269 PF02153 * PDH 1e-35 30.7 %
:HMM:PFM   18->270 PF02153 * PDH 1.3e-59 27.6 250/258  
:BLT:SWISS 51->261 TYRC_ZYMMO 5e-34 31.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21036.1 GT:GENE tyrA GT:PRODUCT prephenate dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(216161..217057) GB:FROM 216161 GB:TO 217057 GB:DIRECTION - GB:GENE tyrA GB:PRODUCT prephenate dehydrogenase GB:PROTEIN_ID AAZ21036.1 GB:DB_XREF GI:71062033 GB:GENE:GENE tyrA LENGTH 298 SQ:AASEQ MKNILIIGCGLIGSSLLRAISEKKIAKKIFVYEKSKSNILKIKKLKLPCEITNDLKQIIPNLDLIIFCTPLGEYEKIILKINRYLLPKTIITDVGSSKEKSMDLIKRKLKKGIFWTSSHPIAGSEVSGPENGVKNLFLKKWCILIKEKNTNRKHLLILTKFWKKIGSKVAIMDSKKHDTIFSMTSHLPHLIAYNLVKTATDFEKQQRYELIKFSAGGLRDFSRIAASNEIMWRDIFFNNQKNISKVIDLFIKNLRSFKRDIQFKNNKSIIKKLVNTKKVRKKIIKLKQDINKPDFGRN GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 51->261|TYRC_ZYMMO|5e-34|31.9|210/293| SEG 4->17|iliigcgligssll| SEG 34->47|ksksnilkikklkl| SEG 271->287|kklvntkkvrkkiiklk| BL:PDB:NREP 1 BL:PDB:REP 63->254|3ggpC|4e-29|35.4|189/286| RP:PDB:NREP 1 RP:PDB:REP 49->258|2b0jA|2e-12|16.3|196/344| RP:PFM:NREP 1 RP:PFM:REP 50->269|PF02153|1e-35|30.7|218/255|PDH| HM:PFM:NREP 1 HM:PFM:REP 18->270|PF02153|1.3e-59|27.6|250/258|PDH| GO:PFM:NREP 2 GO:PFM GO:0004665|"GO:prephenate dehydrogenase (NADP+) activity"|PF02153|IPR003099| GO:PFM GO:0006571|"GO:tyrosine biosynthetic process"|PF02153|IPR003099| RP:SCP:NREP 2 RP:SCP:REP 18->169|2g5cA2|5e-26|26.0|150/171|c.2.1.6| RP:SCP:REP 175->254|2g5cA1|2e-23|43.4|76/107|a.100.1.12| HM:SCP:REP 2->172|2f1kA2|8.9e-32|29.7|165/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 173->285|2f1kA1|2.5e-31|32.7|113/0|a.100.1.12|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 477 OP:NHOMOORG 475 OP:PATTERN -----------------------------------11-11111------------------------- 111-1-----------------------------------1-1-----1-1-11-1------11---11--1111111-111111111-----------111-111-111---------------1-11111111111111---11-11111111111------11-111111111111111111--111--1111111111-11111111111111111111--11111111-11111111111111111111------1---11-------11-111-------11111111111111-------------111111111-11-11-------1-111111---1-1--1111111111111111111--1-11111--1111111111111111111111111111-11111111111-1111111111111111-11111111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111111211111111111111111---------------1111111111-------111111111111111111111111111----11---------------------------1111------------------------------------------------------------------------------------------------------11111---------------111111111111-1111111111111111---------1----------------------------1111111111----------1---------------------------1-------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 71.5 SQ:SECSTR ################################################cEEEccHHHHHTTccEEEEccTTcTTHHHHHHHGGGccTTcEEEEcccccHHHHHHHHHHTTcTTcEEEccccccTTTcccEHHHHHTTTTcccEEEEEccccHHHHHHHHHHHHHHHccEEEEEHHHHHHHHcTTHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHcGGGHGHHHccGGGGGGTGGGGccGGGTTHHHHHHHHHHHTccTT##################################### DISOP:02AL 297-298| PSIPRED ccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccHHHHccHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHcccccEEEEccccccccccccccccHHHHcccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccc //