[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ugd
DDBJ      :ugd          UDPglucose 6-dehydrogenase
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  682/915 : Eukaryota  134/199 : Viruses  1/175   --->[See Alignment]
a.100.1c.2.1c.26.3
:432 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->415 3gg2A PDBj 3e-77 36.2 %
:RPS:PDB   1->413 1dljA PDBj 2e-52 24.9 %
:RPS:SCOP  2->188 1mfzA2  c.2.1.6 * 2e-42 33.9 %
:RPS:SCOP  201->299 1dliA1  a.100.1.4 * 1e-31 35.1 %
:RPS:SCOP  317->428 1mfzA3  c.26.3.1 * 4e-14 22.0 %
:HMM:SCOP  1->206 1dljA2 c.2.1.6 * 9.3e-52 37.8 %
:HMM:SCOP  200->295 1mv8A1 a.100.1.4 * 2.1e-31 44.8 %
:HMM:SCOP  301->428 1mv8A3 c.26.3.1 * 1.2e-31 28.8 %
:RPS:PFM   1->179 PF03721 * UDPG_MGDP_dh_N 2e-30 41.6 %
:RPS:PFM   201->295 PF00984 * UDPG_MGDP_dh 2e-22 48.4 %
:RPS:PFM   319->414 PF03720 * UDPG_MGDP_dh_C 7e-16 37.5 %
:HMM:PFM   1->183 PF03721 * UDPG_MGDP_dh_N 5.2e-69 51.1 182/185  
:HMM:PFM   201->294 PF00984 * UDPG_MGDP_dh 1.8e-36 47.9 94/96  
:HMM:PFM   319->416 PF03720 * UDPG_MGDP_dh_C 8.2e-29 34.7 98/106  
:BLT:SWISS 1->431 UDG_RHIME e-100 43.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21890.1 GT:GENE ugd GT:PRODUCT UDPglucose 6-dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1052286..1053584) GB:FROM 1052286 GB:TO 1053584 GB:DIRECTION - GB:GENE ugd GB:PRODUCT UDPglucose 6-dehydrogenase GB:PROTEIN_ID AAZ21890.1 GB:DB_XREF GI:71062887 GB:GENE:GENE ugd LENGTH 432 SQ:AASEQ MKLCMIGTGYVGLVSGVCFSDLGNDVICVDKDLNKIENLKNGIIPIYEPGLEELLIKNYKNNRLRFSTNLKDSISKSDIIFICVGTPTKKNGNNADLSQVYNVAKEISKSIKRFKIIITKSTVPVTTGDEIEKIISKKVSKKLFSVVSNPEFLREGDAIRDFTYPDRVVIGTHNKKSNKILKNLYSPLISKGAKYVNTSRRAAELIKYASNAFLATKITFINELANLCEKINVNIEDISIGMGLDNRIGSRFLRAGPAYGGSCFPKDTKAITATANKFKTNLTVIKSVIKSNENRSSLMLKKVFEILKNKIKNKNICFLGVTFKANTDDMRDSSSLTMIPALIKKGAKINYFDPTGEKLDFKKFNNVTFSNNIKDAIKKSDLIIIHTEWNDFKNINFKKDVKNKKFSIFDMRNIYSADKMKDNKIKYFSIGN GT:EXON 1|1-432:0| BL:SWS:NREP 1 BL:SWS:REP 1->431|UDG_RHIME|e-100|43.6|431/437| TM:NTM 1 TM:REGION 1->23| SEG 71->80|kdsisksdii| SEG 105->121|keisksikrfkiiitks| SEG 131->148|iekiiskkvskklfsvvs| SEG 306->316|ilknkiknkni| BL:PDB:NREP 1 BL:PDB:REP 1->415|3gg2A|3e-77|36.2|414/431| RP:PDB:NREP 1 RP:PDB:REP 1->413|1dljA|2e-52|24.9|394/402| RP:PFM:NREP 3 RP:PFM:REP 1->179|PF03721|2e-30|41.6|178/186|UDPG_MGDP_dh_N| RP:PFM:REP 201->295|PF00984|2e-22|48.4|95/96|UDPG_MGDP_dh| RP:PFM:REP 319->414|PF03720|7e-16|37.5|96/104|UDPG_MGDP_dh_C| HM:PFM:NREP 3 HM:PFM:REP 1->183|PF03721|5.2e-69|51.1|182/185|UDPG_MGDP_dh_N| HM:PFM:REP 201->294|PF00984|1.8e-36|47.9|94/96|UDPG_MGDP_dh| HM:PFM:REP 319->416|PF03720|8.2e-29|34.7|98/106|UDPG_MGDP_dh_C| GO:PFM:NREP 9 GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF03721|IPR001732| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF03721|IPR001732| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03721|IPR001732| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00984|IPR014026| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF00984|IPR014026| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00984|IPR014026| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF03720|IPR014027| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF03720|IPR014027| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03720|IPR014027| RP:SCP:NREP 3 RP:SCP:REP 2->188|1mfzA2|2e-42|33.9|186/202|c.2.1.6| RP:SCP:REP 201->299|1dliA1|1e-31|35.1|97/98|a.100.1.4| RP:SCP:REP 317->428|1mfzA3|4e-14|22.0|109/136|c.26.3.1| HM:SCP:REP 1->206|1dljA2|9.3e-52|37.8|196/0|c.2.1.6|1/2|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 200->295|1mv8A1|2.1e-31|44.8|96/98|a.100.1.4|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| HM:SCP:REP 301->428|1mv8A3|1.2e-31|28.8|125/136|c.26.3.1|1/1|UDP-glucose/GDP-mannose dehydrogenase C-terminal domain| OP:NHOMO 1408 OP:NHOMOORG 869 OP:PATTERN ---1-11-1111-21-111111-2222112-232-222232231112223133-3422112---2-1- 254-121122311112211-11--1311111-22121324122412211111333211--2211-131212-1111----2-11211265631822---31222143223--------------11211111111121122---113113111111211111111151123111121111211-1-1-12--232334423334232422122233352321332------25211111111111111----1------------------1---1--1----111----2211111-122222222212222-----1---222-12111121112121221111212111----22411214--1-111--3121221-----314213221111411111111112-22132322211-2111111111121111121-121111-1111111122211111------------11111111111111-2-1231111111132232221111334222221233511211121221-11-1-11--131-123--------11-331-1112111112111212221222133232111222221--1---1-------22131312121113111111232-112211-11--1----1111------11211221111111111-11121111111111111111112123211111111112212111111---121111111111111--1133333----132231112-1-----1--11112112112413433335332322-323---------2--122222221-2211212111111111--11111111---------------------------1---------111111111111 --11--1-----21131-1-2212332-------------------1-11111111-212221--------------------------11111111111111112-1322111111111111-2111-131-111111-1111-1111111221111211111121111711213341W312125554-411221111 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 431 STR:RPRED 99.8 SQ:SECSTR cEEEEEcccHHHHHHHHHHTTTTcEEEEEcccHHHHHHHHTTccccccHHHHHHHHHcccccGEEEEccHHHHHHHccEEEEcccccEETTTTEEccHHHHHHHHHHHHHccccEEEEcccccTTHHHHHHHHHHTHHHHTTcccEEEccccccTTcTTHHHHccccEEEEccTTccHHHHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTTccccccccccccccHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccEEEEcccccTTccccTTcHHHHHHHHHHTcccEEEEEcTTcccccccTTcccEEcccHHHHHHHccEEEcccccGGGGGGGGGEEccccHHGccccccGGGGTTccTTcEEEcccc# PSIPRED cEEEEEEccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHccccccccccHHHHHHHHHHcccEEEEccHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccEEEEEccHHHccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccHHHHHHHHHHHcccEEEEEcccccHHHHHHccccEEEccHHHHHHcccEEEEEcccHHHHcccHHHHHHccccEEEEccccccHHHHHHcccEEEEccc //