[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : umuC
DDBJ      :umuC         umuC
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  699/915 : Eukaryota  90/199 : Viruses  1/175   --->[See Alignment]
d.240.1e.8.1
:426 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->192 2rdiA PDBj 5e-21 34.5 %
:RPS:PDB   10->357 3bq0A PDBj 4e-69 21.3 %
:RPS:SCOP  7->210 1t94A2  e.8.1.7 * 2e-47 28.6 %
:RPS:SCOP  247->354 1jihA1  d.240.1.1 * 9e-14 13.5 %
:HMM:SCOP  8->242 1k1sA2 e.8.1.7 * 4.9e-73 39.6 %
:HMM:SCOP  246->353 1t94A1 d.240.1.1 * 1.7e-09 21.8 %
:RPS:PFM   13->157 PF00817 * IMS 9e-21 38.5 %
:RPS:PFM   234->331 PF11799 * IMS_C 7e-08 31.9 %
:HMM:PFM   13->157 PF00817 * IMS 8.5e-41 37.1 143/150  
:HMM:PFM   232->343 PF11799 * IMS_C 5.7e-13 22.7 110/135  
:HMM:PFM   174->197 PF11798 * IMS_HHH 6.4e-06 25.0 24/33  
:BLT:SWISS 11->424 UMUC_SALTY 1e-89 44.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21455.1 GT:GENE umuC GT:PRODUCT umuC GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(620734..622014) GB:FROM 620734 GB:TO 622014 GB:DIRECTION - GB:GENE umuC GB:PRODUCT umuC GB:PROTEIN_ID AAZ21455.1 GB:DB_XREF GI:71062452 GB:GENE:GENE umuC LENGTH 426 SQ:AASEQ MSSIQRTKKIALVDCNSFYVSCERLFNPKIRNKPVVVLSNNDGCIIARSNEAKFLGIKMGEPYFKAKEIILKNKVYVFSSNYSLYGDLSRRVMRTLKRFNPELEIYSVDEAFLDLSNYPDDEVEDVGKEIRSIILQWTGIPTSIGIAKTKTLSKIANHIAKKKQSGVTNLIGIENIDPLLEKIDINDVWGVGKQMTKFYHQNGIYNAKQLKNMSNTWIKKSSNVLSSRTALELRGIPCIPLETKTSKRKSCVVSRSFGTRVEKFQELEEAVASYCLNASEKIRSESLIAKSITVSVRTSPFQNRGVYYSNAKTIDFPIATNNSIEIVKTALIALNEIFINGYRYQKAGITLTGLVSSSGSKNLFSTEKDEKIKGLMRSIDSTNYKYGRSTLSLASAGVNKKWNMRRDHSSKIDTANFHSLPIIKAI GT:EXON 1|1-426:0| BL:SWS:NREP 1 BL:SWS:REP 11->424|UMUC_SALTY|1e-89|44.0|414/422| BL:PDB:NREP 1 BL:PDB:REP 10->192|2rdiA|5e-21|34.5|177/336| RP:PDB:NREP 1 RP:PDB:REP 10->357|3bq0A|4e-69|21.3|334/341| RP:PFM:NREP 2 RP:PFM:REP 13->157|PF00817|9e-21|38.5|143/148|IMS| RP:PFM:REP 234->331|PF11799|7e-08|31.9|91/123|IMS_C| HM:PFM:NREP 3 HM:PFM:REP 13->157|PF00817|8.5e-41|37.1|143/150|IMS| HM:PFM:REP 232->343|PF11799|5.7e-13|22.7|110/135|IMS_C| HM:PFM:REP 174->197|PF11798|6.4e-06|25.0|24/33|IMS_HHH| GO:PFM:NREP 3 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF00817|IPR001126| GO:PFM GO:0003887|"GO:DNA-directed DNA polymerase activity"|PF00817|IPR001126| GO:PFM GO:0006281|"GO:DNA repair"|PF00817|IPR001126| RP:SCP:NREP 2 RP:SCP:REP 7->210|1t94A2|2e-47|28.6|199/308|e.8.1.7| RP:SCP:REP 247->354|1jihA1|9e-14|13.5|104/120|d.240.1.1| HM:SCP:REP 8->242|1k1sA2|4.9e-73|39.6|230/0|e.8.1.7|1/1|DNA/RNA polymerases| HM:SCP:REP 246->353|1t94A1|1.7e-09|21.8|101/0|d.240.1.1|1/1|Lesion bypass DNA polymerase (Y-family), little finger domain| OP:NHOMO 1229 OP:NHOMOORG 816 OP:PATTERN ------1111111111---------11111-1-----------1--11-2122--------1----11 211-211111111122222-23--1422222122222222---122-11111242111--112-11-111111111111122------221--111---21512233232--------------2---111111-2-----111--4--------11111111-2---1--111111111111--------1-22323313113121212222242312-2222232211222222222222222222222225112222-21111--2311223121111111111111111111111211111111111111112221111121111111111-1-21111111211221-111321-12221111111-11-12111-----112221111121111111111111-26-23212231-122222122222111111111111111111111111112-211-----------------------------1111--1111111111111111112111111111-1-1--1111-1----211--111-11421111111113121111311222122222-11111211311111-2111-11---------------1-111223111313-2211347323333121222222----131------231-1322222222322-22252222232322222225321111222121312314433233-122211--211111111211---21-1114332-21221111-1-----11113245211-111-112113131113232441-1111-1-1212211131211212112211121------2-11--11--------1-3----1-1111111111111111111-1--------211 ----11---12----121111---1-1---1-11---1111------1112222-221211111---------1------------11-22222221112---11--1-12-1--12-------22----1------------------1---1---1-1-1-2-111--21241---1-1111--2321111211-1- ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ STR:NPRED 368 STR:RPRED 86.4 SQ:SECSTR #cccccEEEEEEEEETTHHHHHHHHHcGGGTTccEEEccccccEEEEEcHHHHHTTccTTccHHHHHHTcHcTTcEEEEccHHHHHHHHHHHHHHHHTTccEEEEEETTEEEEEcTTTTTHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHTTccccEEcEccGGGHHHHHHHcccTTcTTccHHHHHHHTTTTcccGGGGGGccHHHHHHHHcHHHHHHHHHHHTTccccccccEEEcccEEEEEEEEEEEccHHcHHHHHHHHHHHHHHHHTTTccEEEEEEEEEEETTccEEcccEEEEEEccccccHHHHHHHHHHHHHHHTTccHccccEEEEEEEEEEEEcccccccccccHHH######################################################### DISOP:02AL 1-5, 362-366, 397-413| PSIPRED ccccccccEEEEEEccccEEEEEEcccccccccEEEEEccccEEEEEEcHHHHHccccccccHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHcccEEEccccEEEEEccHHcccHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHccHHHHccccHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHHHHcccccHHHHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHcccccccccHHcccEEEEc //