[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : uvrB
DDBJ      :uvrB         excinuclease ABC chain B
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  884/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
a.2.9b.7.1c.37.1
:723 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->670 2d7dA PDBj 0.0 57.6 %
:RPS:PDB   27->620 1d9zA PDBj e-159 59.9 %
:RPS:PDB   639->677 1e52A PDBj 1e-07 41.0 %
:RPS:SCOP  29->81 2yrbA1  b.7.1.1 * 3e-12 11.3 %
:RPS:SCOP  73->360 2b2nA1  c.37.1.19 * 9e-76 24.1 %
:RPS:SCOP  440->613 1c4oA2  c.37.1.19 * 2e-19 58.0 %
:RPS:SCOP  642->682 1qojA  a.2.9.1 * 5e-08 36.6 %
:HMM:SCOP  26->439 1d9xA1 c.37.1.19 * 1.5e-132 41.7 %
:HMM:SCOP  438->622 2eyqA5 c.37.1.19 * 9.9e-36 30.1 %
:HMM:SCOP  628->683 1e52A_ a.2.9.1 * 1.8e-08 35.7 %
:RPS:PFM   41->143 PF04851 * ResIII 8e-25 53.4 %
:RPS:PFM   492->568 PF00271 * Helicase_C 1e-09 45.8 %
:RPS:PFM   576->619 PF12344 * UvrB 5e-08 59.1 %
:RPS:PFM   643->676 PF02151 * UVR 1e-04 50.0 %
:HMM:PFM   576->619 PF12344 * UvrB 2.1e-21 61.4 44/44  
:HMM:PFM   489->568 PF00271 * Helicase_C 6.8e-18 41.3 75/78  
:HMM:PFM   37->114 PF04851 * ResIII 9.8e-13 30.8 78/184  
:HMM:PFM   646->677 PF02151 * UVR 2.7e-11 50.0 32/36  
:BLT:SWISS 31->704 UVRB_RHILO 0.0 65.9 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20905.1 GT:GENE uvrB GT:PRODUCT excinuclease ABC chain B GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 95195..97366 GB:FROM 95195 GB:TO 97366 GB:DIRECTION + GB:GENE uvrB GB:PRODUCT excinuclease ABC chain B GB:PROTEIN_ID AAZ20905.1 GB:DB_XREF GI:71061902 GB:GENE:GENE uvrB LENGTH 723 SQ:AASEQ MQNTYQDLITEIQSKNPEIHQKLEGGQKFKLVTDFKPAGDQPEAIKQLVKGANKDELSQVLLGVTGSGKTFTMAQVIERTNRPALILAPNKTLAAQLYGEMKSFFPENAVEYFVSYYDYYTPEAYVPRSDTYIEKEASINEQIDRMRHSATRSLLERDDVIIVSSVSCIYGLGSVEAYSKMTLSLKKDYDYNREQLIKTLVHLQYKRNDQSFYRGTFRARGEYIEIFPSHLEDRAWRLSLFGDKLEKIEEFDPLTGDLLKDLDVIKVYANSHYITPKPTIEQAVIKIKRELEVTLKKFKEQNKLLEAQRLEERTKFDLEMIEATGSCAGIENYSRFLSGRKPGEPPPTLFEYFPDNTLIFVDECHVTVPQLNGMYKGDRSRKSNLAEYGFRLPSCMDNRPLKFEEWDAMRTQTVFVSATPGPWELEQTKGKFVEQIIRPTGLIDPPVEIKPAKNQVDDVMHECKKTIDKNFRVLITTLTKKMAEDLTEYFHENGIRVRYLHSDIDTLERIEIMRDLRLGVFDVLVGINLLREGLDIPECALVAILDADKEGFLRSETSLIQTIGRAARNLDGRVILYADKETKSIKKAIQETDRRRTIQVAYNKKHNIDATSIKKEISDVLESVYEKDYLKVGTGDNIGGNLKKHLKQLNKRMKDAATNLEFEEAAKIRDEIRNLEASELEIVLNPKVKHYNQENRVYPKGRSKMGLPGTRAQKGKKKWKQTK GT:EXON 1|1-723:0| BL:SWS:NREP 1 BL:SWS:REP 31->704|UVRB_RHILO|0.0|65.9|672/870| COIL:NAA 22 COIL:NSEG 1 COIL:REGION 292->313| SEG 714->722|kgkkkwkqt| BL:PDB:NREP 1 BL:PDB:REP 28->670|2d7dA|0.0|57.6|618/621| RP:PDB:NREP 2 RP:PDB:REP 27->620|1d9zA|e-159|59.9|589/590| RP:PDB:REP 639->677|1e52A|1e-07|41.0|39/56| RP:PFM:NREP 4 RP:PFM:REP 41->143|PF04851|8e-25|53.4|103/177|ResIII| RP:PFM:REP 492->568|PF00271|1e-09|45.8|72/76|Helicase_C| RP:PFM:REP 576->619|PF12344|5e-08|59.1|44/44|UvrB| RP:PFM:REP 643->676|PF02151|1e-04|50.0|34/36|UVR| HM:PFM:NREP 4 HM:PFM:REP 576->619|PF12344|2.1e-21|61.4|44/44|UvrB| HM:PFM:REP 489->568|PF00271|6.8e-18|41.3|75/78|Helicase_C| HM:PFM:REP 37->114|PF04851|9.8e-13|30.8|78/184|ResIII| HM:PFM:REP 646->677|PF02151|2.7e-11|50.0|32/36|UVR| GO:PFM:NREP 9 GO:PFM GO:0003677|"GO:DNA binding"|PF04851|IPR006935| GO:PFM GO:0005524|"GO:ATP binding"|PF04851|IPR006935| GO:PFM GO:0016787|"GO:hydrolase activity"|PF04851|IPR006935| GO:PFM GO:0003676|"GO:nucleic acid binding"|PF00271|IPR001650| GO:PFM GO:0004386|"GO:helicase activity"|PF00271|IPR001650| GO:PFM GO:0005524|"GO:ATP binding"|PF00271|IPR001650| GO:PFM GO:0003677|"GO:DNA binding"|PF02151|IPR001943| GO:PFM GO:0004518|"GO:nuclease activity"|PF02151|IPR001943| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF02151|IPR001943| RP:SCP:NREP 4 RP:SCP:REP 29->81|2yrbA1|3e-12|11.3|53/142|b.7.1.1| RP:SCP:REP 73->360|2b2nA1|9e-76|24.1|249/308|c.37.1.19| RP:SCP:REP 440->613|1c4oA2|2e-19|58.0|174/174|c.37.1.19| RP:SCP:REP 642->682|1qojA|5e-08|36.6|41/46|a.2.9.1| HM:SCP:REP 26->439|1d9xA1|1.5e-132|41.7|412/413|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 438->622|2eyqA5|9.9e-36|30.1|176/0|c.37.1.19|2/2|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 628->683|1e52A_|1.8e-08|35.7|56/56|a.2.9.1|2/2|C-terminal UvrC-binding domain of UvrB| OP:NHOMO 1121 OP:NHOMOORG 927 OP:PATTERN ------------------------11111111111---1111111111-1111-----1-------11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111121111111111111111111112121111111111111111122122222211211121121222111221122212222221212222222322222222212221111113232222111221112222222111222111111111111111111111111132222222212221111211121221222222222212221122222222222221111111111112111111111111111111111111111-1111111111111111111111111111111211111111111111111111111111---------11111111111111111111111111111111111111111211111-111111111111111111111111211111111111111111111111311111111111122212121211111121111111111111111111111111111111111111112322211322222232111--11111------21111211111111111-1111121111111111112111111112222222222222222211111111-222222222222--1111111111111111111111111-111111111111111111111111111111111111111111111221-111111211111111111111111-1111222211111111112111-1-11111111111111111111111111211111 ---------------------------------------------------------------------------------------------1--------------2--------------------------------------------------1---1---------111--17111--1------1-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 664 STR:RPRED 91.8 SQ:SECSTR #############GGcETTTEEEETTccccccccccccTTHHHHHHHHHHHHHTTccEEEEEEcTTccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHccccEEEEEccTTcccccccEETTTTEEccccccccTHHHHHHHHHHHHTTTcccEEEEEcGGGGccccccTTTccccEEEEccccccTTTHHHHTTTTTcccccccccccccccccTTccccEEccccTTcccccEEEccccccEEEcccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccTTcccccHHHHHHHHHHHHTccccccGGGGHHHHHTccTTcccccGGGccccccEEEETTHHHHHHHHHTHHHHHHHHHHHHHHTTcccGGGTTcccccHHHHHTTcccEEEEcccccHHHHTTcccEEEEEcccTTcccccEEEEEccTTHHHHHHHHHHHHHTTTcEEEEEcccHHHHHHHHHHHHTTcccccccccccccHHHHHHHHHHTTTcccccEEcccccTTcccccEEEEEETTTTcccGGGcHHHHHHHHGGGcccTTcEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccccccccccccHHHHHHHHHHTHHHHccHHHHHHHHHHHHHHHTTcHHHHHHHHHHcEEcEH############################################## DISOP:02AL 1-3, 11-30, 615-643, 677-723| PSIPRED ccHHHHHHHHHHccccccccccccccccEEEEcccccccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHcccccHHHHHHcEEEEEEcccccHHHHHHHHHHHccEEccccccccEEEEEccEEEEEccccccccEEEEEEccEEEEEEEEEcccccEEccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccccccccEEEEEEHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccEEEEEccHHHcccccccccEEEEEccccccccccHHHHHccEEEEccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccHHcccccccccccccccccccccccc //