[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : wcaG
DDBJ      :wcaG         GDP-fucose synthetase chain A
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  289/915 : Eukaryota  94/199 : Viruses  2/175   --->[See Alignment]
c.2.1
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->308 1e6uA PDBj 2e-68 43.7 %
:RPS:PDB   7->311 1e7rA PDBj 1e-28 39.1 %
:RPS:SCOP  7->311 1bsvA  c.2.1.2 * 3e-30 43.4 %
:HMM:SCOP  1->309 2c5aA1 c.2.1.2 * 1.6e-62 31.2 %
:RPS:PFM   8->222 PF01370 * Epimerase 2e-15 32.0 %
:HMM:PFM   8->239 PF01370 * Epimerase 3.7e-68 37.1 221/238  
:BLT:SWISS 1->308 FCL2_ARATH 5e-74 45.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21392.1 GT:GENE wcaG GT:PRODUCT GDP-fucose synthetase chain A GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 562663..563601 GB:FROM 562663 GB:TO 563601 GB:DIRECTION + GB:GENE wcaG GB:PRODUCT GDP-fucose synthetase chain A GB:NOTE substrain RIMD 0509952 GB:PROTEIN_ID AAZ21392.1 GB:DB_XREF GI:71062389 GB:GENE:GENE wcaG LENGTH 312 SQ:AASEQ MINRNSRIFITGHKGLVGSAIYRKLKAKGYTNLLIADRKKLDLTNQIKVIKFLKKKKPDFIFIAAAKVGGIYYNLKYKADFITENLQIQTNLIHGAYKCGIKDLIFLGSSCVYPKNCKQPIKETYLLSGKLEETNDAYAIAKIAGIKMCQSYNEQYKTKYKCLMPTNTYGPNDNYDKNNSHFIPALIKKIHKLKLSKKNTVILWGNGKAKREVIHVDDIAEACIFFMKKKTEHFLINIGTGKDYSIKYYLEFIAKVILGNKKIKIKYDKTKPNGSPRKVMDISLAKKYGWKSKMSLITSIRNTYKSFVRENF GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 1->308|FCL2_ARATH|5e-74|45.1|306/328| SEG 47->63|ikvikflkkkkpdfifi| SEG 186->198|likkihklklskk| SEG 261->271|kkikikydktk| BL:PDB:NREP 1 BL:PDB:REP 7->308|1e6uA|2e-68|43.7|300/315| RP:PDB:NREP 1 RP:PDB:REP 7->311|1e7rA|1e-28|39.1|304/314| RP:PFM:NREP 1 RP:PFM:REP 8->222|PF01370|2e-15|32.0|200/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 8->239|PF01370|3.7e-68|37.1|221/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 7->311|1bsvA|3e-30|43.4|302/317|c.2.1.2| HM:SCP:REP 1->309|2c5aA1|1.6e-62|31.2|298/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 527 OP:NHOMOORG 396 OP:PATTERN ------------------------2---2-----------1---1---11-21-111----------- 121-------------1----1---111111--1-1-1111---1----11-1--1--------2----1----------------111112-211-----1-13211-1-----------------1-111111-111-------1211221111111-111121211111-1-111-2--1-1---------------------------------1------------11---------------------------------------------------------------------------------------------1-----------1-11------------1---11-1------------111-1-------1221-1----2---12--11111-22-22222-1---11-111222--1-1--1-11----1--------------211-----------------------------11-----11-------1-------11-------121--1-1---21----1111----1-1--------------2----11-3212-11112112112-21111--1111---221-5-111111111--1------1--11---1----------------------1--1------11---1-122111111--2112121111211111112--1-1---1111111111111111-11-11111-1-11111111-1----22322----1--------------------------------------1---------1----------------------1--------------1-12111122----------------------------------------------111 11--111-1-1---1------------------------------------1-------------------------------------141-111----11-111--124142241111--1111111381-1221---1111--111-1--111-111231111-112-111111-18111-14464-5A2121111 -----------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 310 STR:RPRED 99.4 SQ:SECSTR ##ccccEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTccccccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTcccHHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccTTcccEEEcccccEEHHHHHHHHHHHHTcccEEEEETTcccccHHHHHTTccccccHHHHHHHHHHHHTHHTH DISOP:02AL 1-4| PSIPRED ccccccEEEEEccccHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEEccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccEEEEEEEEHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHHHHHHHcccccEEEEEEccccccccEEEccHHHHHHccccccccHHHHHHHHHHHHHHccc //