[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yacB
DDBJ      :yacB         Bvg accessory factor
Swiss-Prot:COAX_PELUB   RecName: Full=Type III pantothenate kinase;         EC=2.7.1.33;AltName: Full=Pantothenic acid kinase;AltName: Full=PanK-III;

Homologs  Archaea  0/68 : Bacteria  311/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:248 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   98->221 3djcC PDBj 7e-22 39.5 %
:RPS:PDB   1->240 3djcC PDBj 1e-31 26.6 %
:RPS:SCOP  119->243 2f9tA1  c.55.1.13 * 3e-26 25.2 %
:HMM:SCOP  1->118 2gtdA1 c.55.1.13 * 5.6e-15 26.1 %
:HMM:SCOP  118->246 2gtdA2 c.55.1.13 * 6.2e-34 29.9 %
:RPS:PFM   98->198 PF03309 * Bvg_acc_factor 3e-15 35.6 %
:HMM:PFM   3->198 PF03309 * Bvg_acc_factor 9.3e-47 28.2 195/206  
:BLT:SWISS 1->248 COAX_PELUB e-109 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21713.1 GT:GENE yacB GT:PRODUCT Bvg accessory factor GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 863860..864606 GB:FROM 863860 GB:TO 864606 GB:DIRECTION + GB:GENE yacB GB:PRODUCT Bvg accessory factor GB:NOTE Bordetella pertussis Bvg accessory factor GB:PROTEIN_ID AAZ21713.1 GB:DB_XREF GI:71062710 GB:GENE:GENE yacB LENGTH 248 SQ:AASEQ MIIVGDIGNTETKICLVNSKNIIIKRVILLTKKINHSSLNKSLLGLNLKNKSINKCLFCSVVPKKFNAVKIFFKKVYKIKCHELKKLNLNKLIKIKVNYKQIGSDRLANAISIINNKDNFIILDFGTATTFDVLIKNTYHGGVIAPGVKLSLDTLTDKASQIPKINLKKTNRVIGLNTISAVRAGFFWGYEGLIDNIVNLIKKETKMSFKIIITGGFSGLFKNSIKTKVTLNKDITIKGLIRATTLIK GT:EXON 1|1-248:0| SW:ID COAX_PELUB SW:DE RecName: Full=Type III pantothenate kinase; EC=2.7.1.33;AltName: Full=Pantothenic acid kinase;AltName: Full=PanK-III; SW:GN Name=coaX; OrderedLocusNames=SAR11_0899; SW:KW ATP-binding; Coenzyme A biosynthesis; Complete proteome; Cytoplasm;Kinase; Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->248|COAX_PELUB|e-109|100.0|248/248| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0015937|"GO:coenzyme A biosynthetic process"|Coenzyme A biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 37->55|sslnksllglnlknksink| SEG 69->80|vkiffkkvykik| SEG 84->96|lkklnlnklikik| BL:PDB:NREP 1 BL:PDB:REP 98->221|3djcC|7e-22|39.5|124/256| RP:PDB:NREP 1 RP:PDB:REP 1->240|3djcC|1e-31|26.6|237/256| RP:PFM:NREP 1 RP:PFM:REP 98->198|PF03309|3e-15|35.6|101/203|Bvg_acc_factor| HM:PFM:NREP 1 HM:PFM:REP 3->198|PF03309|9.3e-47|28.2|195/206|Bvg_acc_factor| GO:PFM:NREP 2 GO:PFM GO:0016563|"GO:transcription activator activity"|PF03309|IPR004619| GO:PFM GO:0045941|"GO:positive regulation of transcription"|PF03309|IPR004619| RP:SCP:NREP 1 RP:SCP:REP 119->243|2f9tA1|3e-26|25.2|119/125|c.55.1.13| HM:SCP:REP 1->118|2gtdA1|5.6e-15|26.1|115/0|c.55.1.13|1/1|Actin-like ATPase domain| HM:SCP:REP 118->246|2gtdA2|6.2e-34|29.9|127/0|c.55.1.13|1/1|Actin-like ATPase domain| OP:NHOMO 328 OP:NHOMOORG 311 OP:PATTERN -------------------------------------------------------------------- 111-1---------11111-111111111111111111111111----------------111-11111111---11111211--111--1111-----11111---21----------------11-11111-11---11111-1-------------------------------------11111111-11111111111111111111111111111111111111111------------------------------------------------------------------------------------------11111111111111111111111111212112111121111111111111-2-1111--------------------------------------------------------1111111111111111111111--1111111111111---------------------111111-----------------------------------------------------------------------11111111111111111111111111111111-----------------------------------1------------------------1-----------------------------------------------------------------------------------------------------1111--------------------111111-11--------------------222222222-------------------------------1-11111111111111-11----------------1--------11111111111-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 96.8 SQ:SECSTR cEEEEEEcccEEEEEEEETTEEEEEEEEEEEccccHHHHHHHHHHTTccGGGccEEEEEEccTTTHHHHHHHHHHHTccccEEccTTcccccEEccccTTcccHHHHHHHHHHHHHTcEEEEEEEccEEEEEEEcTcEEEEEEEEEcHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEEccGGGGTTTcTcccEEcTTHHHHHH######## PSIPRED cEEEEEEccccEEEEEEEccEEEEEEEEcccccccHHHHHHHHHHcccccccccEEEEEEccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHccEEEEEEEccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHccccEEEccccHHHHHHHHHHHcc //