[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yaeM
DDBJ      :yaeM         1-deoxy-D-xylulose 5-phosphate reductoisomerase
Swiss-Prot:DXR_PELUB    RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase;         Short=DXP reductoisomerase;         EC=1.1.1.267;AltName: Full=1-deoxyxylulose-5-phosphate reductoisomerase;AltName: Full=2-C-methyl-D-erythritol 4-phosphate synthase;

Homologs  Archaea  0/68 : Bacteria  719/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
a.69.3c.2.1d.81.1
:388 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->376 1q0qA PDBj 5e-51 31.4 %
:RPS:PDB   1->262 3b9gA PDBj 7e-24 5.3 %
:RPS:SCOP  2->149 1jvsA2  c.2.1.3 * 1e-24 27.4 %
:RPS:SCOP  126->254 1jvsA3  d.81.1.3 * 2e-47 41.1 %
:RPS:SCOP  303->372 1jvsA1  a.69.3.1 * 3e-07 23.1 %
:HMM:SCOP  2->149 1r0kA2 c.2.1.3 * 3.5e-37 33.6 %
:HMM:SCOP  125->263 1k5hA3 d.81.1.3 * 8.1e-48 43.2 %
:HMM:SCOP  290->389 1r0kA1 a.69.3.1 * 1.4e-12 20.0 %
:RPS:PFM   4->128 PF02670 * DXP_reductoisom 2e-13 34.7 %
:RPS:PFM   146->228 PF08436 * DXP_redisom_C 1e-24 55.4 %
:HMM:PFM   146->228 PF08436 * DXP_redisom_C 1.8e-40 59.0 83/84  
:HMM:PFM   4->130 PF02670 * DXP_reductoisom 1.3e-31 36.5 126/129  
:BLT:SWISS 1->388 DXR_PELUB 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21725.1 GT:GENE yaeM GT:PRODUCT 1-deoxy-D-xylulose 5-phosphate reductoisomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 876848..878014 GB:FROM 876848 GB:TO 878014 GB:DIRECTION + GB:GENE yaeM GB:PRODUCT 1-deoxy-D-xylulose 5-phosphate reductoisomerase GB:PROTEIN_ID AAZ21725.1 GB:DB_XREF GI:71062722 GB:GENE:GENE yaeM LENGTH 388 SQ:AASEQ MKKIAIFGSTGSIGSSLLKIIKDDQKNFKIELLTVNKNYKKLIKQVKLFNVKNVIVTDYNSFLITTKLLKNAKVKVFNNFDSLNKIFNTNNKIDYSMCAISGFDGLKPTLDIIKFTKTIAIANKESIICGWNLIKKDLKKYKTYFVPVDSEHFSIWSLLDNNKKNNFEKIYITASGGPFRNLSLKKFRNISVKDALKHPNWSMGKKITIDSATMMNKVFEIIEAKKIFNLNYKQLEILIHPKSYLHAIVKFNNGLSKLLVHDTNMTIPIFNSIYFNTDKKLKSKNIDIKTLNNLNLKKIDNIRFPVIKILNNLSNEDSLFETIIVSANDKLVKLFLNNKIKFNDISNTLIKICNTPEFNKFKSMKPRNIDEIQNLNDYVSLKISSMSV GT:EXON 1|1-388:0| SW:ID DXR_PELUB SW:DE RecName: Full=1-deoxy-D-xylulose 5-phosphate reductoisomerase; Short=DXP reductoisomerase; EC=1.1.1.267;AltName: Full=1-deoxyxylulose-5-phosphate reductoisomerase;AltName: Full=2-C-methyl-D-erythritol 4-phosphate synthase; SW:GN Name=dxr; OrderedLocusNames=SAR11_0912; SW:KW Complete proteome; Isoprene biosynthesis; Metal-binding; NADP;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->388|DXR_PELUB|0.0|100.0|388/388| GO:SWS:NREP 4 GO:SWS GO:0008299|"GO:isoprenoid biosynthetic process"|Isoprene biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 284->302|knidiktlnnlnlkkidni| BL:PDB:NREP 1 BL:PDB:REP 1->376|1q0qA|5e-51|31.4|370/398| RP:PDB:NREP 1 RP:PDB:REP 1->262|3b9gA|7e-24|5.3|247/317| RP:PFM:NREP 2 RP:PFM:REP 4->128|PF02670|2e-13|34.7|124/128|DXP_reductoisom| RP:PFM:REP 146->228|PF08436|1e-24|55.4|83/84|DXP_redisom_C| HM:PFM:NREP 2 HM:PFM:REP 146->228|PF08436|1.8e-40|59.0|83/84|DXP_redisom_C| HM:PFM:REP 4->130|PF02670|1.3e-31|36.5|126/129|DXP_reductoisom| GO:PFM:NREP 8 GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF02670|IPR013512| GO:PFM GO:0030604|"GO:1-deoxy-D-xylulose-5-phosphate reductoisomerase activity"|PF02670|IPR013512| GO:PFM GO:0046872|"GO:metal ion binding"|PF02670|IPR013512| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02670|IPR013512| GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF08436|IPR013644| GO:PFM GO:0030604|"GO:1-deoxy-D-xylulose-5-phosphate reductoisomerase activity"|PF08436|IPR013644| GO:PFM GO:0046872|"GO:metal ion binding"|PF08436|IPR013644| GO:PFM GO:0055114|"GO:oxidation reduction"|PF08436|IPR013644| RP:SCP:NREP 3 RP:SCP:REP 2->149|1jvsA2|1e-24|27.4|146/152|c.2.1.3| RP:SCP:REP 126->254|1jvsA3|2e-47|41.1|129/149|d.81.1.3| RP:SCP:REP 303->372|1jvsA1|3e-07|23.1|65/99|a.69.3.1| HM:SCP:REP 2->149|1r0kA2|3.5e-37|33.6|146/151|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 125->263|1k5hA3|8.1e-48|43.2|139/149|d.81.1.3|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| HM:SCP:REP 290->389|1r0kA1|1.4e-12|20.0|95/0|a.69.3.1|1/1|1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain| OP:NHOMO 770 OP:NHOMOORG 743 OP:PATTERN -------------------------------------------------------------------- 111111111111-111111-1111111111111111111111112111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111-----111-11111111111111111111111111111111111111111111111112222221221122211111112121111-11111111111-----------------------------------------------------------------------------------------11111111111111111111111111--111111111111111111111-1111111-----1111111111111------------11111111--1-11111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111--11111--1111111111111-111111-111111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111--------11------------1------1------1111111111111 11------1---------------------------------------------------------------------------------------------------1-----------------------------------------------------------------111119111112122-1211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 97.4 SQ:SECSTR cEEEEEEEcccHHHHHHHHHHHHcTTTEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccEEccHccccEEEccccccccccHHHHTHHHHHHTGGccHHHHHHHHHHHHHHHTccHHHHHHHHHHHccccEEEEEccccTTcEEcTHHHHHHHHHHTHHHHTTEEEEEEEEccccccccccccTTccccccHHHHTcHHHHHHHHTcTTccEEEEcHHHHTTccccHHHHHHGGGGTTcHHHHHHHHHHHHcccccEEHHccTHHHHHHHHHTTcccTTcccccccccccccccccccTTTcTHHHHHHHHHHHcTTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHTcGGGGcccccHHHHHHHHcccTT########## PSIPRED ccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccEEEEccHHHHHHHHHHccccccEEEEcHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccHHHEEEEEEEccccccccccHHHHHcccHHHHHcccccccccEEcccHHHHHHHHHHHHHHHHHccccHHHEEEEEccccEEEEEEEEccccEEEEEccccHHHHHHHHcccccccccccccccHHHcccccccccccccccHHHHHHHHHHcccccEEEEEcHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcc //