[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ycfU
DDBJ      :ycfU         ABC transporter
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  543/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:410 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   267->358 PF02687 * FtsX 3e-10 34.8 %
:HMM:PFM   220->403 PF02687 * FtsX 6.5e-29 24.1 170/175  
:HMM:PFM   176->253 PF11644 * DUF3256 0.00072 25.3 75/199  
:BLT:SWISS 4->410 LOLC_NEIMA 2e-43 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21717.1 GT:GENE ycfU GT:PRODUCT ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 867843..869075 GB:FROM 867843 GB:TO 869075 GB:DIRECTION + GB:GENE ycfU GB:PRODUCT ABC transporter GB:NOTE membrane spanning protein GB:PROTEIN_ID AAZ21717.1 GB:DB_XREF GI:71062714 GB:GENE:GENE ycfU LENGTH 410 SQ:AASEQ MISALEKEITLRYLKTRKKDGFLNIISIFSFIGISLGVAVLIIVMSVMNGFRSELINKIVGFNAHVTVKPYETSINLEKLNSENLKLISKELILSNSGEAIVISKNYTKGLILRGYSRENFLKLDVVKKGNLIGKSNQLTKNSISIGKELSFNLDLSVGDKVSIMSPVGIETIIGSLPRQETFIIRSIFDSGLADFDANIAFINLETLENFFSFKKEDRNLEIYLNKPSNIEEAKNKIQEIFKNEFVYSWADMNSSLFSALKVERNVMFIILSLIIIVAAFNIISGLTILVKNKTRDIAILKSIGVMNKSIVKIFFLVGVIIGTTATLFGIFLGVIFSLYIENLREFLSNTFNISLFPEEIYFLSTMPSEINPTSIFIISLCSIFITIIVSIFPAIKASKLDPVKGLKYE GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 4->410|LOLC_NEIMA|2e-43|27.9|405/415| TM:NTM 4 TM:REGION 24->46| TM:REGION 263->285| TM:REGION 322->344| TM:REGION 373->395| SEG 21->37|gflniisifsfigislg| SEG 74->88|sinleklnsenlkli| SEG 374->389|tsifiislcsifitii| RP:PFM:NREP 1 RP:PFM:REP 267->358|PF02687|3e-10|34.8|92/177|FtsX| HM:PFM:NREP 2 HM:PFM:REP 220->403|PF02687|6.5e-29|24.1|170/175|FtsX| HM:PFM:REP 176->253|PF11644|0.00072|25.3|75/199|DUF3256| GO:PFM:NREP 1 GO:PFM GO:0016020|"GO:membrane"|PF02687|IPR003838| OP:NHOMO 768 OP:NHOMOORG 550 OP:PATTERN ------------------------------------1-----------11422--------------- 111--------------------------------------------------------------------------------111222222-1221--11221-21211-111111--------12112211231------------------------------------------------------1-------------1---1---------------------------------------------------------------------------------------------------------------------1---------------1-------------------1--------11111111111111111131112222211111111111-11111111112-11111111112212111111111111111111111111111111111111111--11-1111111111111111111111111122221111111111111111211111111111111111111121111111111111111111111221111111111111111111121221123111111111111111111111111111112232123222222222222222222222222-11111---11122222222222221221-2222222222222222222222222222222222222222222222222222-222222222222222111111222211111222222111212222111-11111122222222222222232221111111111222222222222221111111111111111112211111--2-12122---------------------------11-------12- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 410-411| PSIPRED cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEccEEEEcccccccHHHHHHHHHHHccccEEEEEEEEEEEEEccEEEEEEEEEEcHHHHccccHHHHHHccccccccccccEEEHHHHHHHcccccccEEEEEEEccccccccccccEEEEEEEEEEEcccHHHccEEEEEEHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccc //