[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ycfV
DDBJ      :ycfV         ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   29->220 2pcjA PDBj 6e-41 40.6 %
:RPS:PDB   29->223 3b5jA PDBj 4e-35 25.3 %
:RPS:SCOP  29->223 1b0uA  c.37.1.12 * 3e-32 31.8 %
:HMM:SCOP  7->220 1ii8.1 c.37.1.12 * 2.4e-56 36.2 %
:RPS:PFM   47->171 PF00005 * ABC_tran 2e-18 43.4 %
:HMM:PFM   47->171 PF00005 * ABC_tran 4.9e-26 37.1 116/118  
:HMM:PFM   15->61 PF03193 * DUF258 8.7e-08 30.4 46/161  
:BLT:SWISS 31->220 LOLD_BACFR 4e-43 43.7 %
:PROS 144->158|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21718.1 GT:GENE ycfV GT:PRODUCT ABC transporter ATP-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 869068..869754 GB:FROM 869068 GB:TO 869754 GB:DIRECTION + GB:GENE ycfV GB:PRODUCT ABC transporter ATP-binding protein GB:PROTEIN_ID AAZ21718.1 GB:DB_XREF GI:71062715 GB:GENE:GENE ycfV LENGTH 228 SQ:AASEQ MNNLISLKNISKSFSNNKKINVLKKINYSFTKGKIYSLVGPSGSGKSTLLNVLSLIDKPTTGSLIINKTPVNFNENAKNDKIRSSKIGIIYQQNNLLPDFTALENVYLAGLALTNDKKNSIERAKEIIKTMGLSSREAHFPSELSGGEMQRIAMARALINEPEIILADEPTGSLDHTTAKEVFNVLYKLKNKNRLIIYATHNRFFANMADCKLEMIDGNIKAINARIK GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 31->220|LOLD_BACFR|4e-43|43.7|190/216| PROS 144->158|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 4->27|lislknisksfsnnkkinvlkkin| BL:PDB:NREP 1 BL:PDB:REP 29->220|2pcjA|6e-41|40.6|192/223| RP:PDB:NREP 1 RP:PDB:REP 29->223|3b5jA|4e-35|25.3|194/243| RP:PFM:NREP 1 RP:PFM:REP 47->171|PF00005|2e-18|43.4|113/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 47->171|PF00005|4.9e-26|37.1|116/118|ABC_tran| HM:PFM:REP 15->61|PF03193|8.7e-08|30.4|46/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 29->223|1b0uA|3e-32|31.8|195/258|c.37.1.12| HM:SCP:REP 7->220|1ii8.1|2.4e-56|36.2|210/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 44859 OP:NHOMOORG 1175 OP:PATTERN QQLAQIHJUSURUOaPjIOLKNKUoNQbiSaPHDFEFCHGFFDWaOTjLR**g7RfQVXNRLLGX18B PZlI*ZaYeeiQbPXQRLL-LbAAW*MMMMMLnjhkk***PvS*mznYogaO*zsJPZ9Anlte*ir***aaaaaxYVYPxdhDCD9CSRRL5KGIH-1HGUMLJeLYIR8999A99ACCCCCCHUPMTXMKSTWQejjv*LKIyRmfjmYWjVaOPIFGEKDXWWgwx*YJKHKJHJKHLHHZURLKrh9RZv********************x***ckv**hksstoor**almmlmihjjllljiZgbcc*mYazxZPdWirqOP**YWPWkghjmrqtsqmtqvunsnokkntkonYYZYXYaZbZZXXsjigghkilij*z*********j*ls***bjkh*shuxzinQJ**qnZahoTZjdqdNdZSNYUSSILLJJKZU***WQi****v***********-ge*aY*h***OC**************EGI**********POPPPPPPsXbIMdUy55667777546777AB87A9697798796KDCCCDx**s*******toprn*****uyybx***w**xALpphwdkei*t****ZhdJULNiPHIHHGFGQOKVfddz*OcSriXgpZYmLcbXRUVhTUZaTbntayNJMRHNNMOMGCCEEEFEEEHTIGJKJifrMsSdMWOwPSVXTNTdSRQSPUYWVbV5-AIPMM321222*s**R*tv***w***tv-zvtwzw*wxx**wrsusrp*****jkhikfggihhgieghggf*ojippppT5************34IIEFDEFJLMKKH*g*aZZZUYJPRMMUOTgMOQPOERGOQlanonov***px*rtc***HGGEFGGFGJfqo*nooooz*w**LLKHGIIFHGBBBB77KWTSJLJL98777978*CUBBBCD-EDECKEEONOBFIEFD667WgtWVo*qkmDbL 1233bZF-VH79MWPC9FB7GJEKDLGEDAB8BJGG9GCDEDE89AGCBLIFRKEEH98BBC65745526648A6461656967AA44-CG5998B888994AKD95NTiVOSLYWPHBB9ESJhh9mB**d3aNdHFE9Y9EaR7IECBUB9*EQOKiEY*FiOZBwWY*XfRHDICC*BBA9KqZf*C*mELiXebQ ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 223-228| PSIPRED ccccEEEEEEEEEEccccEEEEEcccEEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEcccccc //