[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yciB
DDBJ      :yciB         intracellular septation protein A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  360/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:183 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->179 PF04279 * IspA 1e-26 45.9 %
:HMM:PFM   6->181 PF04279 * IspA 8.8e-59 42.5 174/176  
:BLT:SWISS 6->182 ISPZ_AGRT5 6e-34 41.1 %
:TM
:REPEAT 2|10->65|66->112

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21110.1 GT:GENE yciB GT:PRODUCT intracellular septation protein A GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 290074..290625 GB:FROM 290074 GB:TO 290625 GB:DIRECTION + GB:GENE yciB GB:PRODUCT intracellular septation protein A GB:PROTEIN_ID AAZ21110.1 GB:DB_XREF GI:71062107 GB:GENE:GENE yciB LENGTH 183 SQ:AASEQ MNKSFLKFATDFGPLAIFFYYYYNNDKNLAVAIPPLIVATLTALAVVWFFEKKIPMMPLISGILITFFGGLTIYFDDPVFIYVKPTIINILFALALYFGKYFTKEPVLKKIMGKSIALTDMGWELLNKRWMYFFFFLAILNECVWRTQTEEFWVNFKVWGMLPITLVFTAFQISLINKYKLDE GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 6->182|ISPZ_AGRT5|6e-34|41.1|175/204| TM:NTM 5 TM:REGION 29->51| TM:REGION 54->76| TM:REGION 79->101| TM:REGION 130->151| TM:REGION 156->178| NREPEAT 1 REPEAT 2|10->65|66->112| RP:PFM:NREP 1 RP:PFM:REP 7->179|PF04279|1e-26|45.9|170/175|IspA| HM:PFM:NREP 1 HM:PFM:REP 6->181|PF04279|8.8e-59|42.5|174/176|IspA| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF04279|IPR006008| OP:NHOMO 362 OP:NHOMOORG 361 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-111111111121111111111111111-11111111111-------------111----------111111111111111----1111111111111111111111111111111111-11111111111111111111111111111111111111111----------------------------------------------------------11111---11--11111111111111111111--11--11--11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1-11111111111111111111111111111111111-1111-11111111-1111-111111111111111111111111111--------------1-1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 181-183| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //