[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yedZ
DDBJ      :yedZ         probable membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  184/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:HMM:PFM   50->154 PF01794 * Ferric_reduct 3.2e-15 21.2 104/125  
:BLT:SWISS 21->169 Y1687_XANC5 2e-26 38.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21576.1 GT:GENE yedZ GT:PRODUCT probable membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(737308..737877) GB:FROM 737308 GB:TO 737877 GB:DIRECTION - GB:GENE yedZ GB:PRODUCT probable membrane protein GB:PROTEIN_ID AAZ21576.1 GB:DB_XREF GI:71062573 GB:GENE:GENE yedZ LENGTH 189 SQ:AASEQ MQKYIKIPIFFFCLLPILIIVYQIIFNQLGPEPVKKITHVTGEWTLRFIIITLAMTPLQKFTELNFWISYRRMFGLFVFFYASAHMMTYVGIDYRFDWSSIGDDIIKKKFIFAGFLAWLLLVPLALTSSKRMIRLLRDKWKKLHKLVYIISLLGIIHYLWLVKVVTVEPLIYLIIIVILLTLRVKMKFN GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 21->169|Y1687_XANC5|2e-26|38.9|149/218| TM:NTM 5 TM:REGION 6->28| TM:REGION 41->63| TM:REGION 73->94| TM:REGION 110->129| TM:REGION 153->175| SEG 5->20|ikipifffcllpilii| SEG 103->126|ddiikkkfifagflawlllvplal| SEG 170->182|liyliiivilltl| HM:PFM:NREP 1 HM:PFM:REP 50->154|PF01794|3.2e-15|21.2|104/125|Ferric_reduct| OP:NHOMO 187 OP:NHOMOORG 184 OP:PATTERN -------------------------------------------------------------------- 111----------------------------------------------------------------------------------------------------------------------------------------11---1----------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111------1------------11111111111---1--1-1----111111111111-----1--111111111111111-11112-1-----------------------------1-----111111111111111111111111111111111-11111111111111-11---111------------11------------------------11--11------------------------------1-1111-1-112111-1111111111111----1-1------------------------------------------1--------1111111111111111-----------------------------------2-1-1-------------------------1-----1-1--1111-111--------------------------1111111-------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccc //