[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yeeE
DDBJ      :yeeE         conserved hypothetical membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:HMM:PFM   85->125 PF04143 * DUF395 6.6e-12 42.5 40/43  
:HMM:PFM   36->57 PF12575 * DUF3753 0.00036 31.8 22/72  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22062.1 GT:GENE yeeE GT:PRODUCT conserved hypothetical membrane protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1197640..1198059) GB:FROM 1197640 GB:TO 1198059 GB:DIRECTION - GB:GENE yeeE GB:PRODUCT conserved hypothetical membrane protein GB:PROTEIN_ID AAZ22062.1 GB:DB_XREF GI:71063059 GB:GENE:GENE yeeE LENGTH 139 SQ:AASEQ MNIVNFTPISAFLGGSLIGLAVIIFFVFNGRLIGISGIASNFLTSKDNRFDNFLFLIGLIIGPIVYKIFTQQEINITISNSFYLLAIAGLLVGAGTRIGGGCTSGHGISGIGRFSLRSIIATVTFMIVGILTVLVKNLI GT:EXON 1|1-139:0| TM:NTM 4 TM:REGION 12->34| TM:REGION 51->73| TM:REGION 75->97| TM:REGION 116->138| SEG 53->62|flfligliig| SEG 84->112|llaiagllvgagtrigggctsghgisgig| HM:PFM:NREP 2 HM:PFM:REP 85->125|PF04143|6.6e-12|42.5|40/43|DUF395| HM:PFM:REP 36->57|PF12575|0.00036|31.8|22/72|DUF3753| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHc //