[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yggS
DDBJ      :yggS         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  790/915 : Eukaryota  158/199 : Viruses  0/175   --->[See Alignment]
c.1.6
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->214 1w8gA PDBj 4e-23 33.5 %
:RPS:PDB   26->212 3cpgA PDBj 9e-34 27.2 %
:RPS:SCOP  27->213 1b54A  c.1.6.2 * 2e-27 33.7 %
:HMM:SCOP  1->213 1ct5A_ c.1.6.2 * 5.3e-63 40.5 %
:RPS:PFM   26->215 PF01168 * Ala_racemase_N 1e-15 34.4 %
:HMM:PFM   19->215 PF01168 * Ala_racemase_N 3.4e-38 27.6 174/214  
:BLT:SWISS 26->215 Y112_PASMU 5e-32 38.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21183.1 GT:GENE yggS GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 353591..354241 GB:FROM 353591 GB:TO 354241 GB:DIRECTION + GB:GENE yggS GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ21183.1 GB:DB_XREF GI:71062180 GB:GENE:GENE yggS LENGTH 216 SQ:AASEQ MHNTVKNLIYIEDLVKSKVNHVKLPKIIAVSKTFPIENILPLIEYGHLHFGENKVQEALDKWVHIKNQNPSIQLHLIGRLQTNKVKVALRIFDYIHALDSEKLANKIADEQTKQGKKPKIFIQVNIGNENQKSGINKERLSDFYKFCKNLNLDIIGTMCIPPNDDNTKKYFSEMNEINQELDFKELSMGMSGDYLEAIRYNATYVRVGSKIFGSRT GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 26->215|Y112_PASMU|5e-32|38.9|190/233| BL:PDB:NREP 1 BL:PDB:REP 27->214|1w8gA|4e-23|33.5|188/226| RP:PDB:NREP 1 RP:PDB:REP 26->212|3cpgA|9e-34|27.2|184/247| RP:PFM:NREP 1 RP:PFM:REP 26->215|PF01168|1e-15|34.4|180/211|Ala_racemase_N| HM:PFM:NREP 1 HM:PFM:REP 19->215|PF01168|3.4e-38|27.6|174/214|Ala_racemase_N| RP:SCP:NREP 1 RP:SCP:REP 27->213|1b54A|2e-27|33.7|184/230|c.1.6.2| HM:SCP:REP 1->213|1ct5A_|5.3e-63|40.5|210/0|c.1.6.2|1/1|PLP-binding barrel| OP:NHOMO 1016 OP:NHOMOORG 952 OP:PATTERN -------------------------------------------------1111--------------- 1111111111111111111-1111121111111---11111-1-11-1-111111-----11-111111111111111111111111111111111---11211121211--------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------11--------1111111111111111111111111111111111111111111111111111111111111121111111111-11111111111111111111-11111111111111111111112121111111111112-1111111111111111111111111111111111111111111111111111112-----------------------------111111222121111111111111111111111111112-111211111211111121211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--111111--11111211211111111111-11111111111111111111112211111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111221111111111111111111111--------1-1-------------------------1111111111111 1-11111-2111-11111111111--1------1111111-11---111111-1--1-1111111111-1111111111111111111--2-11111111-11111-1--12-11121-1-11-21111241-1111--131111-1---11-1-111134212111112111311-11F1111121111311111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 96.8 SQ:SECSTR ######HHHHHHHHHHHHHHTcccEEEEEEcTTccHHHHHHHHHHHTccEEEccHHHHHHHHHHHccccEEEcEEEcccccGGGHHHHTTTccEEEEEccHHHHHHHHHHHHHHTccEEEEEEccccccTTcccccGGGHHHHHHHHHTcTEEEEEEccccccccHHHHHHHHHHHHHHHHTcTTccEEEcTTTHHHHHTTccEEEEcTTTcccc# DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHcccHHcccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHHccccEEcccccHHHHHHHHHcccEEEEccccccccc //