[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ygiH
DDBJ      :ygiH         hypothetical protein
Swiss-Prot:Y1082_PELUB  RecName: Full=UPF0078 membrane protein SAR11_1082;

Homologs  Archaea  0/68 : Bacteria  665/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->65 1gv1D PDBj 4e-04 43.8 %
:RPS:PFM   8->181 PF02660 * DUF205 5e-26 42.5 %
:HMM:PFM   9->180 PF02660 * DUF205 4.5e-61 44.8 172/178  
:BLT:SWISS 1->191 Y1082_PELUB 3e-97 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21886.1 GT:GENE ygiH GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1048322..1048897 GB:FROM 1048322 GB:TO 1048897 GB:DIRECTION + GB:GENE ygiH GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAZ21886.1 GB:DB_XREF GI:71062883 GB:GENE:GENE ygiH LENGTH 191 SQ:AASEQ MEYLIVALSSYLLGSIPFGFILTKIFLKKDIRDIGSGNIGATNALRTGNKTLGYATLLLDITKAVLPVLYVKFNYPDYIFIASLSAFLGHVFPIWLKFKGGKGVATYVGILFSINIFLGLVFIISWAVTFLISKYSSLSSLVGSLMVPMYLIVFENYNSIFFIIMFVLIFYTHRENVKRLKNKEETKTKIY GT:EXON 1|1-191:0| SW:ID Y1082_PELUB SW:DE RecName: Full=UPF0078 membrane protein SAR11_1082; SW:GN OrderedLocusNames=SAR11_1082; SW:KW Cell inner membrane; Cell membrane; Complete proteome; Membrane;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->191|Y1082_PELUB|3e-97|100.0|191/191| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 6 TM:REGION 4->26| TM:REGION 51->72| TM:REGION 77->97| TM:REGION 108->130| TM:REGION 133->154| TM:REGION 156->177| SEG 131->145|liskysslsslvgsl| BL:PDB:NREP 1 BL:PDB:REP 34->65|1gv1D|4e-04|43.8|32/292| RP:PFM:NREP 1 RP:PFM:REP 8->181|PF02660|5e-26|42.5|174/178|DUF205| HM:PFM:NREP 1 HM:PFM:REP 9->180|PF02660|4.5e-61|44.8|172/178|DUF205| GO:PFM:NREP 1 GO:PFM GO:0005886|"GO:plasma membrane"|PF02660|IPR003811| OP:NHOMO 724 OP:NHOMOORG 667 OP:PATTERN -------------------------------------------------------------------- 111---------------------------------------------------------------------------1111111111-----------------11-11---------------11111111121-----2241-1-1-111--1111111-11-1111111111111111111-1144111133333223122222211111122211122111111111111111111111111111111121111212221111111111111111111111111111111111111111111111111111111111131111111-----1--1------2-111111-111111122121113111-1-11111111111111111111-111111111111-1111111111111111111111111-111111111111111111111-111-1111111111111---------------1111111--1-111111111111111--11111111111111111111-11111111111111111-1-------1111-1---11111111111111111111111111---11111111111111111111---11--1111--111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111111111---111111111111111------------111111-1----1-1-1111111111111111111111111--------------1111111111----------111111-11111-1---11-11111121221212211-1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 32 STR:RPRED 16.8 SQ:SECSTR #################################EcccHHHHHHHHHHHHTTcccEEEEEcccccH############################################################################################################################## DISOP:02AL 190-192| PSIPRED cHHHHHHHHHHHHccHHHHHHHHHHHccccHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //