[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ygjD
DDBJ      :ygjD         O-sialoglycoprotein endopeptidase
Swiss-Prot:GCP_PELUB    RecName: Full=Probable O-sialoglycoprotein endopeptidase;         Short=Glycoprotease;         EC=3.4.24.57;

Homologs  Archaea  68/68 : Bacteria  905/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:357 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->326 2ivnA PDBj 2e-41 36.7 %
:RPS:PDB   7->208 2a6aA PDBj 1e-38 16.6 %
:RPS:SCOP  62->318 2ewsA1  c.55.1.14 * 1e-32 12.9 %
:HMM:SCOP  5->324 1huxA_ c.55.1.5 * 3.8e-37 32.4 %
:RPS:PFM   53->318 PF00814 * Peptidase_M22 2e-67 49.2 %
:HMM:PFM   31->318 PF00814 * Peptidase_M22 1e-95 50.2 267/268  
:BLT:SWISS 1->357 GCP_PELUB 0.0 100.0 %
:PROS 104->124|PS01016|GLYCOPROTEASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21133.1 GT:GENE ygjD GT:PRODUCT O-sialoglycoprotein endopeptidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 307618..308691 GB:FROM 307618 GB:TO 308691 GB:DIRECTION + GB:GENE ygjD GB:PRODUCT O-sialoglycoprotein endopeptidase GB:PROTEIN_ID AAZ21133.1 GB:DB_XREF GI:71062130 GB:GENE:GENE ygjD LENGTH 357 SQ:AASEQ MNKKPIILGIESSCDETAASIITENEQGMPTILSSIVSSQVDVHKEFGGVVPELAARSHMEKIDLITKKAFDKSGVKMEDLDAIAATAGPGLMVCLSVGLSFGKAMASSLNKPFIAVNHLEGHALSPKLNSELNYPYLLLLISGGHTQFLSVQGLGNYKRLGTTIDDAVGEAFDKTAKLLGIEFPGGPQIEVYAKKGDPNKYELPKPIFHKGGCNLSFAGLKTAVLKISKQIKTEQEKYDLAASFQKTIEEILYKKSKIAFEEFKKMNTINKNKFVVAGGVAANKRIREVLTNLCKEEEFEAIFPPINLCGDNAAMIAMVGLEKFKLKQFSELDSPAKPRWPLDADAAFLKGAGVRL GT:EXON 1|1-357:0| SW:ID GCP_PELUB SW:DE RecName: Full=Probable O-sialoglycoprotein endopeptidase; Short=Glycoprotease; EC=3.4.24.57; SW:GN Name=gcp; OrderedLocusNames=SAR11_0311; SW:KW Complete proteome; Hydrolase; Metal-binding; Metalloprotease;Protease; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->357|GCP_PELUB|0.0|100.0|357/357| GO:SWS:NREP 4 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0008237|"GO:metallopeptidase activity"|Metalloprotease| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| PROS 104->124|PS01016|GLYCOPROTEASE|PDOC00779| BL:PDB:NREP 1 BL:PDB:REP 6->326|2ivnA|2e-41|36.7|297/325| RP:PDB:NREP 1 RP:PDB:REP 7->208|2a6aA|1e-38|16.6|175/191| RP:PFM:NREP 1 RP:PFM:REP 53->318|PF00814|2e-67|49.2|256/260|Peptidase_M22| HM:PFM:NREP 1 HM:PFM:REP 31->318|PF00814|1e-95|50.2|267/268|Peptidase_M22| GO:PFM:NREP 2 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF00814|IPR000905| GO:PFM GO:0006508|"GO:proteolysis"|PF00814|IPR000905| RP:SCP:NREP 1 RP:SCP:REP 62->318|2ewsA1|1e-32|12.9|240/260|c.55.1.14| HM:SCP:REP 5->324|1huxA_|3.8e-37|32.4|253/0|c.55.1.5|1/1|Actin-like ATPase domain| OP:NHOMO 1372 OP:NHOMOORG 1164 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111121111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111111111111111111112112122111112221111111111211111111111111111111111111111111-111111111111111111111111111111111111111111111111111111122111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111-11111111111111111111111111111111 1111222-311-111222222222222222222121222212222222222222122222-222222212222221212222222222-13222221112232212123242222212-1222233221382-21221122-2221211222121112221122223223422222-22F2222222332322142222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 351 STR:RPRED 98.3 SQ:SECSTR ###ccEEEEEEccTccEEEEEEETTEcHHHHEEEEHHHGGGGGGccEEEEHEEcccGGGGGHHHHHHHHHHHHHTccGGGccEEEEEcccccHHHHHHHHHHHHHHHGGGTccEEEEcHHHHHHTccccEccTTEEEEEEEEEccccEEEEEccEEEEEEEEHHHHHHHHHHHcccEEEEccccccHHHHHHHHHTTccccGGGTTHHTcGGGcccccHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccEEEEEcGGGGcHHHHHHHHHHHTEEEcEEEEccTTHHHHHHHHHHHHTTccccHHHHHHHHHTTccccccGcccccccccc### DISOP:02AL 1-2| PSIPRED cccccEEEEEcccccHHEEEEEEccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHccccccEEEEEEEcccEEEEEEEccccEEEcccccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccEEccccccccccccEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEcHHHcccHHHHHHHHHHHHHHccccccccEEcccccccccccHHHHHHcccc //