[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yhbG
DDBJ      :yhbG         probable sulfate/thiosulfate import ATP-binding protein cysA
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:258 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   17->243 2yyzA PDBj 8e-29 30.9 %
:RPS:PDB   16->250 3b5jA PDBj 5e-41 25.9 %
:RPS:SCOP  19->256 1b0uA  c.37.1.12 * 3e-41 25.7 %
:HMM:SCOP  15->257 1g6hA_ c.37.1.12 * 4.9e-61 33.2 %
:RPS:PFM   58->178 PF00005 * ABC_tran 6e-14 50.5 %
:HMM:PFM   58->180 PF00005 * ABC_tran 3e-22 40.5 116/118  
:HMM:PFM   22->74 PF03193 * DUF258 1.5e-06 23.1 52/161  
:BLT:SWISS 19->256 LPTB_HAEIN 1e-44 38.1 %
:PROS 153->167|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21317.1 GT:GENE yhbG GT:PRODUCT probable sulfate/thiosulfate import ATP-binding protein cysA GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(483672..484448) GB:FROM 483672 GB:TO 484448 GB:DIRECTION - GB:GENE yhbG GB:PRODUCT probable sulfate/thiosulfate import ATP-binding protein cysA GB:NOTE YhbG GB:PROTEIN_ID AAZ21317.1 GB:DB_XREF GI:71062314 GB:GENE:GENE yhbG LENGTH 258 SQ:AASEQ MGVIKKFRIKSFKNPQPFISLENISLSFGKRKILDNVSFKINHGQILGMLGPNGVGKSTIFNLITGLIKPDFGKIKFEGIDVVDYPIYLRTTKFRIGYVPQYGGYFSDLTLLENLKAIAEIVIDDKNLIHHKIDMLIAKFELDAIRDIKAKFLSGGQKKKLVIALALLSDPKVLLLDECFAALDVLTIKMLQEIIVNLQTESNITICICDHQARDLLSCVDVAVILSNCKIVAQGSPNELINNTEAKNAYFGDSFKFN GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 19->256|LPTB_HAEIN|1e-44|38.1|236/241| PROS 153->167|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 17->243|2yyzA|8e-29|30.9|223/358| RP:PDB:NREP 1 RP:PDB:REP 16->250|3b5jA|5e-41|25.9|232/243| RP:PFM:NREP 1 RP:PFM:REP 58->178|PF00005|6e-14|50.5|111/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 58->180|PF00005|3e-22|40.5|116/118|ABC_tran| HM:PFM:REP 22->74|PF03193|1.5e-06|23.1|52/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 19->256|1b0uA|3e-41|25.7|237/258|c.37.1.12| HM:SCP:REP 15->257|1g6hA_|4.9e-61|33.2|241/254|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 46169 OP:NHOMOORG 1173 OP:PATTERN MML9PGGKWVVSXRZPeGNMJLMctJMaiVYULBDDFBJIJGBTbNVgNO*vd9PiSTbLOLKDV379 RXoK*UYZddcSZKQPPKK-Kd77X*LLLLLOnhfjp***QxU*csgalRPFzsrNJfFFhizaxko***eUYXXwaXXL*dbDAB8DRTQQ6ODIL--HIXOPLiRbRY687777889A7777JNPKPROJRPVPgllkwKJL*ZliqwhhiUaSTKEJHGCcgVh***bKPINHKGNHNEHcSWPKskAUfy*******************vz***fqs**gpxyyuuu**coppnpllmmooommZgbdc*ndg**gQkdr**TT**gYVYmkmllqpuyrnz***x*xvqty*uxxccdcacddfdbcb*psjijusvtt***********o*pw***gnoi*zkx**ntRK**lhacgfPZkdmuOZfVNdTTUKKKLJMZR***VSo**********x*y***-ej*aW*Z***PC**************KFI**********QQQQQQQQlNTJQfUv886787776578B8DEAACBB9BBA95B7LCBDCFz**********pvvxq********l*******wCOuuo*jibg******TfiHWIPfVHJLILJISTMXbib**SfTphSisWUfKZWZQRUeROSUWUoxa*NOMTINNNOMI7AAAABBAAINFHJHFlhqRnSaJOKuRVXZWMUbVTSTTXXYYXZ4-FLMKL421444*y**T*srxxxswuxpq-urqsyuvstqvwslmqomr*****iigijghhjjjjjfhjhhf*ljhppqpN5************24HFGJGGGNOPOODzd*babYXYJORMLVNRjMNQNNGREJOkWooimq***nxzssb***HFGEFGIFFLdml*nmoom**xorMKOJJJIJLMFCDCA9MVTRNONP88788988*DbC999E-BDEAEFCLMI9FLCDB667clsYVh*ekfEaL 3488heJ-YI7GVfSIHJDELLJRHSHHG9BABRKNBMHKHKKDAAIDKMKQUMGJK8DCCDFAD6A83AB6BGE8D2BC9FDDAN44-LP8HHFGB9BC87DLKF6PPlnRUSneeNJFBLaKrjAwF**m3oTtJLLBcLJgYFNGFFeFC*IaTOpHi*OlReB*Yf*ffVRGMIH*HIGHPygh*E*tJNygsqU ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-17| PSIPRED cccccccccccccccccEEEEEEEEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccEEEEEccccccc //