[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yhdW
DDBJ      :yhdW         ABC transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  241/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->249 1xt8B PDBj 2e-13 29.0 %
:RPS:PDB   10->262 2a5sA PDBj 1e-24 12.2 %
:RPS:SCOP  41->262 1xt8A1  c.94.1.1 * 1e-24 25.8 %
:HMM:SCOP  41->264 1ftkA_ c.94.1.1 * 1.3e-43 31.5 %
:RPS:PFM   84->253 PF00497 * SBP_bac_3 8e-04 28.8 %
:HMM:PFM   43->262 PF00497 * SBP_bac_3 8.6e-32 28.1 210/225  
:BLT:SWISS 41->346 AAPJ_RHIL3 1e-96 55.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21762.1 GT:GENE yhdW GT:PRODUCT ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 936342..937382 GB:FROM 936342 GB:TO 937382 GB:DIRECTION + GB:GENE yhdW GB:PRODUCT ABC transporter GB:NOTE similar to amino acid binding protein Mesorhizobium loti GB:PROTEIN_ID AAZ21762.1 GB:DB_XREF GI:71062759 GB:GENE:GENE yhdW LENGTH 346 SQ:AASEQ MFKYVKQLTSLVAMVAVLFTFTTETMAAKKSKTLKNTQKKGFVRCGVSQGLPGFSNADAAGNWTGVDVDVCRAVAAAVLGDANKVKFTPLSAKERFTALTSGEIDILSRNTTWTLSRDADIGLTFVGVNFYDGQGFMVRKDSGITSTSQFKNGISACTNIGTTTELNMRDFFNSKGISYEPVAFEKADEVVAAYDSGRCDTYTTDKSGLAAQRTKMTNPDDHVVLPETISKEPLGPVVRQGDAVWEDIVRWSLNVMIEAEEYGINSANADMMKTSENPQIKRLVGSEGELGAAFGLDNDWSLRIIKQVGNYGESYKRNIADTGILPDRGPNQIWTKGGLLYVPPAR GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 41->346|AAPJ_RHIL3|1e-96|55.1|305/341| SEG 29->40|kksktlkntqkk| SEG 66->78|vdvdvcravaaav| BL:PDB:NREP 1 BL:PDB:REP 41->249|1xt8B|2e-13|29.0|200/251| RP:PDB:NREP 1 RP:PDB:REP 10->262|2a5sA|1e-24|12.2|246/278| RP:PFM:NREP 1 RP:PFM:REP 84->253|PF00497|8e-04|28.8|163/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 43->262|PF00497|8.6e-32|28.1|210/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 41->262|1xt8A1|1e-24|25.8|213/248|c.94.1.1| HM:SCP:REP 41->264|1ftkA_|1.3e-43|31.5|216/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 334 OP:NHOMOORG 244 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------1-----------------1--1---1-----------------------------------------------------------------------11122-----1111111111111111-----11-2-1111--1111---------------------------1---11---11-----------11----------------------------------------------------------------------------------------------------------------------1--1-12---------------------2----1113232223122211221222223---1--2--211121111211133222---1111122114--------------14-----------------------------1--11-24432-------------12---------2213-12212-111211121--1-----1-----------2---5-12-1113111-----------------2---1-111111-----------1------1-------2--------------------------------1122-11-111111111-111111111111111-111---121-------------------1112111--1--------------------------113----------------------1111-22221112111111121----------11111111111111----------------2-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1----2----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 318 STR:RPRED 91.9 SQ:SECSTR #########EEEEcccTTTcEEEEccccccccTTccHHTTEEEEEEEEcccccccEEEEEEEEEcHHHHHHHHHHHHHccccccccEETTEEcHHHHHHHTTcccEEcccccccHHHHTTETEEEccccEEEcEEEEEETTcccccTTcHHccccEEccTTcHHHHHHHTTcHHHHHHHGGGccccHHHHHHHHHTTcccEEEEEHHHHHHHHHTcTTccEEEEEcccGGGcEEEccEEETTcTTHHHHHHHHHHHHHHTHHHHGGcEEEEEEEEHcHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHTccHHHHHHHHcTTccTTc################### DISOP:02AL 1-5| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccEEEEEEcccccccEEEccccccccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccEEEEEccccccccHHHHcccccccHHHHcEEEEEEEcccccccHHHHHcccEEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHcccEEEEEEcHHHHHHHHHHccccccEEEcccccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEEEccccccccccccHHHHHHHHHHHccHHHHHHHHcccccccccccccccHHccccccccccc //