[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yhdX
DDBJ      :yhdX         amino acid ABC transporter
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  625/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   275->311 3dhwA PDBj 4e-08 35.1 %
:RPS:SCOP  38->129,266->377 2r6gG1  f.58.1.1 * 1e-10 18.8 %
:HMM:PFM   87->376 PF00528 * BPD_transp_1 1.4e-08 17.6 176/185  
:BLT:SWISS 26->381 YHDX_ECOLI 1e-78 46.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21763.1 GT:GENE yhdX GT:PRODUCT amino acid ABC transporter GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 937448..938593 GB:FROM 937448 GB:TO 938593 GB:DIRECTION + GB:GENE yhdX GB:PRODUCT amino acid ABC transporter GB:NOTE similar to permease protein VC1361 Vibrio cholerae (strain N16961) GB:PROTEIN_ID AAZ21763.1 GB:DB_XREF GI:71062760 GB:GENE:GENE yhdX LENGTH 381 SQ:AASEQ MKLKKILPQLLTLLFIVLIFGFFTMNAQENMDTRGIEFGFGFLTQEASFDIQFSLIDYDGSHSYARAYLVGLLNTLLVAFIGIILATLLGLIVGVARLSPNYLIRKTASFYIEFFRNVPLLLQIFFWYFAALRALPMPQDATLLLGSSFMTIKGLYTPAPIWTNFDIFFTTLIVAMILIFFFVKFAKKKQEQEGKQLPVLIISLAIFIGLPLLTFLVGGVDLSFSFPELRKMSQSSYTFDGGMGIPPELIALTLALTLYTATFIAENVRAGIQGIGKGQKEAAASIGLTPSQVLKLVIMPQALRIIIPPTTNQYLNLTKNSSLAAAIAYPDLVLVFAGTAMMQTGKAIEIVGITMATYLTISIAISLLMNWYNQRIAIKEK GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 26->381|YHDX_ECOLI|1e-78|46.2|351/393| TM:NTM 7 TM:REGION 6->26| TM:REGION 71->93| TM:REGION 113->135| TM:REGION 165->185| TM:REGION 201->223| TM:REGION 320->342| TM:REGION 348->370| SEG 2->23|klkkilpqlltllfivlifgff| SEG 81->96|igiilatllglivgva| SEG 249->265|lialtlaltlytatfia| RP:PDB:NREP 1 RP:PDB:REP 275->311|3dhwA|4e-08|35.1|37/203| HM:PFM:NREP 1 HM:PFM:REP 87->376|PF00528|1.4e-08|17.6|176/185|BPD_transp_1| RP:SCP:NREP 1 RP:SCP:REP 38->129,266->377|2r6gG1|1e-10|18.8|204/284|f.58.1.1| OP:NHOMO 2041 OP:NHOMOORG 643 OP:PATTERN -----1---------------------2--1111-----111---111--1-1----2---------- ----22122221113------3---6------4222116312224131211-542122--1-11334536212222222-2-1----------------------------------1------------------111231111-2223223331111212--1--3312-2212--2212-123--11--244444447644554455222464452321221222222531222222222222221221133334441434334455143443222444412213333323333333333333333333333533355541223355443341211222222211-1-2113144-2-21-1111111121--11122111121E65111222211222123222C-226226169912F448987CBGEB92---12331452241111111122211-25-----------------------------1--11-3A95956576623666448866666674H555412766633545394AA223----532222222---12-119-593934A77721-1--2----------1-221-333331-1--------11----332-------2-1111--11111111-11--------------45993564444443444-4464444444444344334797BA4443332333233333333733243331-544444434444--2------------3362221121----111-11211-11221-7557699C367662778----------3333333336655511---------------2----------------1-------------------------1-1-114111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------1-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 37 STR:RPRED 9.7 SQ:SECSTR ##################################################################################################################################################################################################################################################################################ccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHH###################################################################### DISOP:02AL 379-381| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //