[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yhdY
DDBJ      :yhdY         Similar to amino-acid ABC transporter permease protein yhdY
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  695/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:426 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   216->356 3dhwA PDBj 6e-10 28.4 %
:RPS:PDB   320->359 3dhwA PDBj 1e-07 34.3 %
:RPS:SCOP  218->419 2r6gG1  f.58.1.1 * 3e-23 14.4 %
:RPS:PFM   233->359 PF00528 * BPD_transp_1 1e-08 30.1 %
:HMM:PFM   237->411 PF00528 * BPD_transp_1 9.7e-22 21.1 166/185  
:BLT:SWISS 112->426 YHDY_ECOLI 1e-92 51.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21764.1 GT:GENE yhdY GT:PRODUCT Similar to amino-acid ABC transporter permease protein yhdY GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 938593..939873 GB:FROM 938593 GB:TO 939873 GB:DIRECTION + GB:GENE yhdY GB:PRODUCT Similar to amino-acid ABC transporter permease protein yhdY GB:PROTEIN_ID AAZ21764.1 GB:DB_XREF GI:71062761 GB:GENE:GENE yhdY LENGTH 426 SQ:AASEQ MNSKNLDLSKSKIQINRNTSLIIGILFFFLGIFDFCLNNFLGTNITSFLPRFINFFTPLIFGVIGLHFIRIEFSGIKILDSLNKNINPSNFNAALSLCIIFLIIFSLPPLLNWFIFDANISGDTKEACTGGGACWVYIKVWFNRFMYGMYPNAEQWRINITFIAVLSFMAAGFFVPAKFRNYLSLYYTLILPIISFILIYYLISGGSFGLEWVETGAWGGLSLTFIVSFFSLIFCFPIGMMLALGRRSDLPVVKYSSLSFIEFWRGVPLITVLFMSAVMFPMFLPDGTYVDKLIRVVVAITLFEAAYTAEVIRGGLQALPRGQYDAAKSLGMGYWKLHIFVILPQALKLVIPGIANTFLALVKDTPLIFVVGLLEVVGMLNLAKTNPEWLGFSMEGYVFAGIIFWIICYSMSKYSQKLELKYKTDR GT:EXON 1|1-426:0| BL:SWS:NREP 1 BL:SWS:REP 112->426|YHDY_ECOLI|1e-92|51.8|311/367| TM:NTM 9 TM:REGION 18->40| TM:REGION 95->117| TM:REGION 160->178| TM:REGION 185->207| TM:REGION 221->243| TM:REGION 274->296| TM:REGION 336->358| TM:REGION 363->385| TM:REGION 395->415| SEG 21->33|liigilffflgif| SEG 95->111|lslciifliifslppll| SEG 189->204|lilpiisfiliyylis| BL:PDB:NREP 1 BL:PDB:REP 216->356|3dhwA|6e-10|28.4|134/203| RP:PDB:NREP 1 RP:PDB:REP 320->359|3dhwA|1e-07|34.3|35/203| RP:PFM:NREP 1 RP:PFM:REP 233->359|PF00528|1e-08|30.1|123/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 237->411|PF00528|9.7e-22|21.1|166/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 218->419|2r6gG1|3e-23|14.4|202/284|f.58.1.1| OP:NHOMO 4149 OP:NHOMOORG 729 OP:PATTERN 11--12----------1-1111114--11-2211----1122--2222--1-1----2------2--- ----43133333214------5--1C------644436C914225283533-769135--222-577A594755576631421---------------------------11111111111111-----1--4---222441111-1234223331111111--1--3322-2112--2212-1341111--27455555875566556623398556333744355555396222222222222222222246757AB885676666B93756C533388886664AA888777888876666566666666757A987778135455645455232344423332122142331AA-4122-1111111171--11137444422L56122311112364336456O-22D22B27DK22nPPNQUSTTfLLL7---25G656844B1111111132411-49----------111111111111111--1-4--21-5HFBHKLLKMIA8BBBEEIOCBCC9BFFV77941297A94754A8DEKM234----A44422222---24-11K-997C56BAAA42-23-3-------1--6-4441666663231111211-13----79B-3-----B-1111--11111111-11-1---1--------78JH4B98998887887-98A8888888988788779DHBKI6666564666666666655C776777711BAAAAA99AAAA--3-222221111--77E44442422212222166666-54553-ECCEHOIR8EHCD5KIK----------7779999999986611---------------2----------------3-------------------------132-114111--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1------6-----------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 163 STR:RPRED 38.3 SQ:SECSTR #######################################################################################################################################################################################################################HHHHHHHHHHHHHHHHHHTTGGGGGGGGGGTTccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHTTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHHcTTccH################################################ DISOP:02AL 1-10, 424-426| PSIPRED cccccccccHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHHHHHccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //