[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yhdZ
DDBJ      :yhdZ         general L-amino acid transport ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:244 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->243 2oukB PDBj 2e-70 52.7 %
:RPS:PDB   5->233 3b5jA PDBj 9e-49 30.0 %
:RPS:SCOP  4->244 1b0uA  c.37.1.12 * 2e-54 45.2 %
:HMM:SCOP  1->237 1tq4A_ c.37.1.8 * 8.6e-73 38.4 %
:RPS:PFM   45->169 PF00005 * ABC_tran 3e-18 40.0 %
:HMM:PFM   45->169 PF00005 * ABC_tran 4.6e-30 37.9 116/118  
:HMM:PFM   141->219 PF09818 * ABC_ATPase 0.00033 34.2 79/448  
:HMM:PFM   20->62 PF03193 * DUF258 1.9e-06 31.0 42/161  
:BLT:SWISS 2->244 YHDZ_ECOLI 5e-98 67.5 %
:PROS 141->155|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21765.1 GT:GENE yhdZ GT:PRODUCT general L-amino acid transport ATP-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 939877..940611 GB:FROM 939877 GB:TO 940611 GB:DIRECTION + GB:GENE yhdZ GB:PRODUCT general L-amino acid transport ATP-binding protein GB:PROTEIN_ID AAZ21765.1 GB:DB_XREF GI:71062762 GB:GENE:GENE yhdZ LENGTH 244 SQ:AASEQ MSDSIIQIQNVNKWFGDFQVLKEINLEVKPKEKIVVCGPSGSGKSTLIRCINRLEEHQKGSIIVDGTEISEDTKNIEQVRAEVGMVFQQFNLFPHLSILDNCTLAPIWVKKMPKKEAEKLALEHLERVQILDQAQKFPGQLSGGQQQRVAIARALCMEPKIMLFDEPTSALDPEMIKEVLDVMVNLAKQGMTMIVVTHEMGFAKEVADQMIFMDEGMIVEKATTKDFFANPKSDRTKLFLSQIL GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 2->244|YHDZ_ECOLI|5e-98|67.5|243/252| PROS 141->155|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 114->126|kkeaeklalehle| BL:PDB:NREP 1 BL:PDB:REP 5->243|2oukB|2e-70|52.7|239/241| RP:PDB:NREP 1 RP:PDB:REP 5->233|3b5jA|9e-49|30.0|227/243| RP:PFM:NREP 1 RP:PFM:REP 45->169|PF00005|3e-18|40.0|120/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 45->169|PF00005|4.6e-30|37.9|116/118|ABC_tran| HM:PFM:REP 141->219|PF09818|0.00033|34.2|79/448|ABC_ATPase| HM:PFM:REP 20->62|PF03193|1.9e-06|31.0|42/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 4->244|1b0uA|2e-54|45.2|241/258|c.37.1.12| HM:SCP:REP 1->237|1tq4A_|8.6e-73|38.4|229/400|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 47922 OP:NHOMOORG 1173 OP:PATTERN VVI9OIIIUUURUPTKjFOOMOOXzPRhoVgVJCDBCBGGHFDQYRRmOQ**h9SbRRQITHJCW179 UchM*eZannoRZMTORLL-Lf99U*LLLLLMpkklt***T*V*t*ucqiXP**tPRdBBqu*b*s****eYXXXxcaYQ*eiABDACTSPI5LDGK--GFRKKKZLVMPAAAAAAADDDBBBBHTPLPWNKSUZOkrs**IIJyXukntkjkXcVXOGMGOIhdZg***cIOFJKIHPJIGGhabTSwjAYet*******************yw***gpv**ikuvwrsq**WijkkkhhijjjiiiagbacujUb*zYPdWkppMN**aTPZdiefhomoqrlvrtsrvqssptwottYZYXXZbbbaZWXvkgbabhhjll*z*********e*hm***ZbbZ*pipt*YkRL**nkYYfnTbicmgQcZXObVWWMKLLKMdU***WTp****************-rs*mi*o***UB**************GIL**********QPQQQQQQvaeKOhX*55555444666766AB5786786687585LDFFFF************************n********BM**u*szpv******colQWJRjXHIHHIHHRQPcxka**QeU*oYitZXkHdaYUVZgVZZbUaoyXyPKIPFMMMNMIBBCDDCDCCJQGFGNMqjrQwUeLRMwRWXXXNXcUTUUSWbYXXY5-BJTSM311222*w**Z*uuzzyv***tt-yutvyvzvxxz*wtttssq*****fhjllhjkmlllmijljjj*ojjnnnrW3************33IHDECDEMNONPL*r*XXVYdUKNRKKTLSgLNOPNFSIQVnYyxwyz***u**x*m***CGGEFFGFGKhpn*qrrrrz*t**RQSNNNNNONEDDD56KUPPLLLLA8797998*AWECFDC-EAFFIJDTRP9HJDHHAAAaduVUp*qplDcO 1343bMC-PC59MTNHCGBDGIERFPFFE7CBBLHKAHEFCFEABBCEFLIHVJGFJEFBBBA5B47527756865516559667844-CE7CEE8777A87BIHA3Jae*XcVmbnIFHEJWGrnCzA**o2qSkJEJBdEKhRELHEDbCA*HYUQsIf*JtMYElWd*aflPD8CC*9A8DGfTW*AkfBEzZdiG ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 244-245| PSIPRED ccccEEEEEEEEEEEccEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccccHHHHHHHccEEEEcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHcccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHHc //