[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ytoQ
DDBJ      :ytoQ         hypothetical protein ytoQ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.23.14
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:SCOP  1->122 1s2dA  c.23.14.1 * 4e-09 16.5 %
:RPS:PFM   5->144 PF11071 * DUF2872 5e-51 60.0 %
:HMM:PFM   5->145 PF11071 * DUF2872 2.7e-71 61.7 141/141  
:BLT:SWISS 4->145 YTOQ_BACSU 2e-32 45.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20903.1 GT:GENE ytoQ GT:PRODUCT hypothetical protein ytoQ GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(93511..93960) GB:FROM 93511 GB:TO 93960 GB:DIRECTION - GB:GENE ytoQ GB:PRODUCT hypothetical protein ytoQ GB:PROTEIN_ID AAZ20903.1 GB:DB_XREF GI:71061900 GB:GENE:GENE ytoQ LENGTH 149 SQ:AASEQ MLNVYLAGEIHSNWREEITQLCEKEKLDIKFTFPVTDHEASDNCGVEILGAEEKNFWKDRKGANINSIRTKKSIQDCDVIIVKFGEKFKQWNAAFDAGYATALNKSMIVIHNDDHQHALKEVDGSAAAVASDQKQAFRILKYILEGSLD GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 4->145|YTOQ_BACSU|2e-32|45.1|142/100| RP:PFM:NREP 1 RP:PFM:REP 5->144|PF11071|5e-51|60.0|140/141|DUF2872| HM:PFM:NREP 1 HM:PFM:REP 5->145|PF11071|2.7e-71|61.7|141/141|DUF2872| RP:SCP:NREP 1 RP:SCP:REP 1->122|1s2dA|4e-09|16.5|115/165|c.23.14.1| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------1--2--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111111-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----111---------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------1-------------------------11-----------------------------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 55 STR:RPRED 36.9 SQ:SECSTR #########################################################################################GGTcGGGGGGGTEEEEEEEEEcTTcccEEEEEccTTEEEEEEcccccccEEEEEE##### DISOP:02AL 148-150| PSIPRED cEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHcHHHcEEEEcHHHHHHHHHHHHHcccc //