[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : yxkH
DDBJ      :yxkH         polysaccharide deacetylase-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  277/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:236 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   59->174 2iw0A PDBj 9e-06 33.7 %
:RPS:PDB   53->218 2cc0A PDBj 3e-20 18.2 %
:RPS:SCOP  53->218 2cc0A1  c.6.2.3 * 1e-20 18.2 %
:HMM:SCOP  19->195 1ny1A_ c.6.2.3 * 3e-31 30.0 %
:RPS:PFM   54->183 PF01522 * Polysacc_deac_1 8e-16 41.6 %
:HMM:PFM   53->183 PF01522 * Polysacc_deac_1 2.3e-27 28.9 114/124  
:BLT:SWISS 6->212 YXKH_BACSU 1e-20 34.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21820.1 GT:GENE yxkH GT:PRODUCT polysaccharide deacetylase-like protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 992704..993414 GB:FROM 992704 GB:TO 993414 GB:DIRECTION + GB:GENE yxkH GB:PRODUCT polysaccharide deacetylase-like protein GB:NOTE Xylanase/chitin deacetylase family enzyme GB:PROTEIN_ID AAZ21820.1 GB:DB_XREF GI:71062817 GB:GENE:GENE yxkH LENGTH 236 SQ:AASEQ MSTSNKVPILMYHSISDSKNSLSLSVDKFYNQMNFMKKKGYNTINLNEINQNDKNKFIITFDDGYEDVLINALPILKKFDFKATCFFVTDYLNLHNIWDQHKNDFILLKTMSKIQVDEWLKNGMTIGSHTSSHKNLQKININEKISQISRSKNFFKEEFNIDVKFFSYPYGSYDNETVKIIKKYYEFAVTTKRSRYIKDKFNEYLLPRVPVNKNDSLVKFFLKIKTPYEDIKYKND GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 6->212|YXKH_BACSU|1e-20|34.9|192/279| SEG 14->28|sisdsknslslsvdk| BL:PDB:NREP 1 BL:PDB:REP 59->174|2iw0A|9e-06|33.7|104/226| RP:PDB:NREP 1 RP:PDB:REP 53->218|2cc0A|3e-20|18.2|148/192| RP:PFM:NREP 1 RP:PFM:REP 54->183|PF01522|8e-16|41.6|113/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 53->183|PF01522|2.3e-27|28.9|114/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 53->218|2cc0A1|1e-20|18.2|148/192|c.6.2.3| HM:SCP:REP 19->195|1ny1A_|3e-31|30.0|160/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 314 OP:NHOMOORG 277 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------11-----------------------1--1------------1-1111-------------1-1-----1------------------------1---------11---1----------------11---------------------12--122222--4-212--1--1111-211-11----------3----1------------1-------------11-----1----11111-1111111-----------111111111111111111111111--321111111212--112111-2-------11111---11----1-3111-----------------------11111111111-11-11---11--1---11-111-------------1------------------------------------------------2-----1111--1122----------------1--2--------------111----11----------------1--------------------1-------------3122----------------111-1111---11111--1111-11111111--1----------------1--11-1111111131-1111112122111111112111-----111111111111111111111111--111-11111111---------------1-----------------1111111----1-------------------------------11-11---------------1111------1111----------------------------------------1-----1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 94.5 SQ:SECSTR #####cccccccTTTTcccccccGGGccEEccccGGGTccccccccccccTcccEEEEEEEEccccTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHTTHHHHHHHHHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcccHHHHHHHHHTTcEEccccEEccGGGTccHHHHHHHHHTccTTcEHHHHGGGTTc######## DISOP:02AL 1-3, 230-232, 234-236| PSIPRED cccccccEEEEEEccccccccEEEcHHHHHHHHHHHHHcccccccHHHHHcccccEEEEEEEccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHcccEEEEEEccccccccccHHHccEEEEcccccHHHHHHHHcccccccccccc //