[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02555.1
DDBJ      :             competence locus E protein 3-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:244 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->129 PF03772 * Competence 5e-06 28.0 %
:HMM:PFM   2->243 PF03772 * Competence 1.4e-47 27.9 226/271  
:BLT:SWISS 97->194 COMEC_BACSU 4e-04 26.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02555.1 GT:GENE AAL02555.1 GT:PRODUCT competence locus E protein 3-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(15687..16421) GB:FROM 15687 GB:TO 16421 GB:DIRECTION - GB:PRODUCT competence locus E protein 3-like protein GB:PROTEIN_ID AAL02555.1 GB:DB_XREF GI:15619050 LENGTH 244 SQ:AASEQ MQDMRQNGISHVLCVSGLHLSLVVMIIFLTTRFLLNLSNYLAYNFNIKLISAYCSLIGSFGYLELSGMQAATRAFITAAIFIYGIIFIGRSCFPLHSLAIAAFIILSLNPEYIFHPSFQLSFIAVLSLVAGYEFYLKNSWLLGEKKGIFGAVKFYTASNIYSSFLASIITAPVVINQFFIFATYSVPANLIVVPITLFFLMPLALLSLPFTMIGFDNYILKLMGFFIDIIIKSAAYFNSLPAAV GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 97->194|COMEC_BACSU|4e-04|26.2|84/776| TM:NTM 7 TM:REGION 10->32| TM:REGION 45->67| TM:REGION 80->102| TM:REGION 114->135| TM:REGION 162->184| TM:REGION 191->213| TM:REGION 215->237| SEG 70->88|aatrafitaaifiygiifi| SEG 197->210|lfflmplallslpf| RP:PFM:NREP 1 RP:PFM:REP 5->129|PF03772|5e-06|28.0|118/271|Competence| HM:PFM:NREP 1 HM:PFM:REP 2->243|PF03772|1.4e-47|27.9|226/271|Competence| OP:NHOMO 77 OP:NHOMOORG 76 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------11-1-------1------1---------------------11--------------------------------------------------------------1--------------------------------------1------------------------------------------------------------------------------------------------------------------------1-----------1------------11-11111-------1----1----------1-----------1-----11111111-11-1-1111111--111111111----1--1-1----11111-112111-1-11-1-11--1--1------------------------------------------------------------------------1--------------1--1-1--------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 244-245| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccc //