[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02576.1
DDBJ      :             folate synthesis bifunctional protein-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.30
:79 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->73 2cg8B PDBj 1e-04 34.5 %
:RPS:PDB   2->78 1cbkA PDBj 6e-14 26.4 %
:RPS:SCOP  2->78 1cbkA  d.58.30.1 * 7e-14 26.4 %
:HMM:SCOP  1->78 1f9yA_ d.58.30.1 * 6.2e-07 31.5 %
:RPS:PFM   3->76 PF01288 * HPPK 6e-05 34.8 %
:HMM:PFM   3->77 PF01288 * HPPK 6.3e-14 35.7 70/127  
:BLT:SWISS 2->76 FOLKP_CHLTR 7e-14 42.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02576.1 GT:GENE AAL02576.1 GT:PRODUCT folate synthesis bifunctional protein-like protein GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(35819..36058) GB:FROM 35819 GB:TO 36058 GB:DIRECTION - GB:PRODUCT folate synthesis bifunctional protein-like protein GB:PROTEIN_ID AAL02576.1 GB:DB_XREF GI:15619073 LENGTH 79 SQ:AASEQ MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQAIIFETQAILQPNADKAWDKSYLNMVVQGKSTLTPSKLLIELNKD GT:EXON 1|1-79:0| BL:SWS:NREP 1 BL:SWS:REP 2->76|FOLKP_CHLTR|7e-14|42.7|75/450| BL:PDB:NREP 1 BL:PDB:REP 3->73|2cg8B|1e-04|34.5|58/247| RP:PDB:NREP 1 RP:PDB:REP 2->78|1cbkA|6e-14|26.4|72/160| RP:PFM:NREP 1 RP:PFM:REP 3->76|PF01288|6e-05|34.8|69/126|HPPK| HM:PFM:NREP 1 HM:PFM:REP 3->77|PF01288|6.3e-14|35.7|70/127|HPPK| GO:PFM:NREP 2 GO:PFM GO:0003848|"GO:2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity"|PF01288|IPR000550| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF01288|IPR000550| RP:SCP:NREP 1 RP:SCP:REP 2->78|1cbkA|7e-14|26.4|72/160|d.58.30.1| HM:SCP:REP 1->78|1f9yA_|6.2e-07|31.5|73/0|d.58.30.1|1/1|6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------11111111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111------11-11----1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 92.4 SQ:SECSTR #EEEEEEEccccHHHHHHHHHHHHHTcTTEEEEEEccEEEcccccccccc####cEEEEEEEEEEcccHHHHHHHHHH# DISOP:02AL 78-80| PSIPRED cEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccccccEEEEEEEEEEcccHHHHHHHHHcc //