[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02579.1
DDBJ      :             unknown
Swiss-Prot:Y041_RICCN   RecName: Full=Uncharacterized protein RC0041;

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:89 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->71 PF01030 * Recep_L_domain 0.00024 17.0 47/112  
:BLT:SWISS 1->89 Y041_RICCN 4e-37 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02579.1 GT:GENE AAL02579.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(38531..38800) GB:FROM 38531 GB:TO 38800 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL02579.1 GB:DB_XREF GI:15619076 LENGTH 89 SQ:AASEQ MPKTDKLKQLIDIVNYYKQLEDNAKTIGNFLETVKKLNQLLETPKSENKLENLLNYLKYIYLTSNFPKKKIWLHLILQNGLTIYLPRGI GT:EXON 1|1-89:0| SW:ID Y041_RICCN SW:DE RecName: Full=Uncharacterized protein RC0041; SW:GN OrderedLocusNames=RC0041; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|Y041_RICCN|4e-37|100.0|89/100| SEG 47->62|enklenllnylkyiyl| HM:PFM:NREP 1 HM:PFM:REP 25->71|PF01030|0.00024|17.0|47/112|Recep_L_domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEcccc //