[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rickettsia conorii str. Malish 7 (rcon0)
Gene : AAL02583.1
DDBJ      :             unknown
Swiss-Prot:Y045_RICCN   RecName: Full=Uncharacterized protein RC0045;

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->82 PF06728 * PIG-U 0.00014 14.1 78/174  
:BLT:SWISS 1->108 Y045_RICCN 5e-40 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL02583.1 GT:GENE AAL02583.1 GT:PRODUCT unknown GT:DATABASE GIB00062CH01 GT:ORG rcon0 GB:ACCESSION GIB00062CH01 GB:LOCATION complement(42377..42703) GB:FROM 42377 GB:TO 42703 GB:DIRECTION - GB:PRODUCT unknown GB:PROTEIN_ID AAL02583.1 GB:DB_XREF GI:15619080 LENGTH 108 SQ:AASEQ MNCPLSLQIVNVSYIVNTNSCSWIAFNNSKYPIKTIKINIININILGKINHMVIFCDNNIVIILWKIMVVIISSIIHRTYIRRWISRRNNIRRKASHACKQPNNTTGC GT:EXON 1|1-108:0| SW:ID Y045_RICCN SW:DE RecName: Full=Uncharacterized protein RC0045; SW:GN OrderedLocusNames=RC0045; SW:KW Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->108|Y045_RICCN|5e-40|100.0|108/100| GO:SWS:NREP 2 GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 13->35| TM:REGION 54->76| SEG 33->50|iktikiniininilgkin| SEG 81->93|irrwisrrnnirr| HM:PFM:NREP 1 HM:PFM:REP 2->82|PF06728|0.00014|14.1|78/174|PIG-U| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 94-101, 103-108| PSIPRED ccccEEEEEEEEEEEEEcccEEEEEEccccccEEEEEEEEEEEEEEEEEcEEEEEEcccEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccc //